EVI-1 Antibody (1E7) - Azide and BSA Free

Sandwich ELISA: EVI-1 Antibody (1E7) [H00004197-M01] - Detection limit for recombinant GST tagged MDS1 is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EVI-1 Antibody (1E7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MDS1 (NP_004982, 80 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS
• Specificity: MDS1 - myelodysplasia syndrome 1 (1E7)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MECOM
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EVI-1 Antibody (1E7) - Azide and BSA Free

• AML1-EVI-1 fusion protein
• AML1-EVI-1
• ecotropic viral integration site 1
• Ecotropic virus integration site 1 protein homolog
• EVI1
• EVI-1
• EVI1MDS1-EVI1
• MDS1 and EVI1 complex locus protein EVI1
• MDS1 and EVI1 complex locus protein MDS1
• MDS1 and EVI1 complex locus
• MDS1
• MECOM
• MGC163392
• MGC97004
• Myelodysplasia syndrome 1 protein
• myelodysplasia syndrome 1
• Myelodysplasia syndrome-associated protein 1
• oncogene EVI1
• PRDM3
• zinc finger protein Evi1

Background

EVI1 (ecotropic viral integration site 1) was originally identified as a gene located in the integration site of ecotropic retroviruses in the mouse genome that resulted in myeloid tumors. EVI1 is a zinc finger transcription factor that plays an important role in development and leukemogenesis. It is an oncogene that can have effects on cell proliferation, differentiation, and apoptosis. Chromosomal translocations involving EVI1 result in chronic myelogenous leukemia (CML). Alternate names for EVI1 include AML1-EVI-1 fusion protein, PRDM3, and MDS1-EV1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MECOM
• Entrez:
  • 4197(Human)
• Uniprot:
  • NP_004982(Human)