ESD Antibody

Images

 
Western Blot: ESD Antibody [NBP1-89479] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ESD Antibody [NBP1-89479] - Staining of human cell line A-431 shows positivity in golgi apparatus.
Immunohistochemistry-Paraffin: ESD Antibody [NBP1-89479] - Staining of human stomach shows strong dot like cytoplasmic positivity in glandular cells.
Western Blot: ESD Antibody [NBP1-89479] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ESD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ESD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
ESD Protein (NBP1-89479PEP)
Publications
Read Publication using
NBP1-89479 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ESD Antibody

  • EC 3.1.2.12
  • esterase 10
  • esterase Desterase D/formylglutathione hydrolase
  • FGH
  • FLJ11763
  • S-formylglutathione hydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-85982
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF5075
Species: Hu, Mu, Rt
Applications: WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-3077
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ESD Antibody (NBP1-89479)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ESD Antibody (NBP1-89479) (0)

There are no reviews for ESD Antibody (NBP1-89479). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ESD Antibody (NBP1-89479) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ESD Antibody Products

Related Products by Gene

Bioinformatics Tool for ESD Antibody (NBP1-89479)

Discover related pathways, diseases and genes to ESD Antibody (NBP1-89479). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ESD Antibody (NBP1-89479)

Discover more about diseases related to ESD Antibody (NBP1-89479).
 

Pathways for ESD Antibody (NBP1-89479)

View related products by pathway.

PTMs for ESD Antibody (NBP1-89479)

Learn more about PTMs related to ESD Antibody (NBP1-89479).

Blogs on ESD

There are no specific blogs for ESD, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our ESD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ESD

Customers Who Bought This Also Bought