ESD Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ESD Antibody [NBP1-89479] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: ESD Antibody [NBP1-89479] - Staining of human stomach shows strong dot like cytoplasmic positivity in glandular cells.

Analysis in human cell line HL-60.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ESD Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ESD Antibody - BSA Free (NBP1-89479) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ESD Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAG
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ESD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ESD Protein (NBP1-89479PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ESD Antibody - BSA Free

• EC 3.1.2.12
• esterase 10
• esterase Desterase D/formylglutathione hydrolase
• FGH
• FLJ11763
• S-formylglutathione hydrolase

Background

ESD encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ESD Antibody (NBP1-89479)(1)

Publication using NBP1-89479

• Donadio E, Giusti L, Seccia V et al. New Insight into Benign Tumours of Major Salivary Glands by Proteomic Approach. PLoS One 2013-08-26 [PMID: 24205396] (WB, Human)

Bioinformatics

• Gene Symbol: ESD