Home » ERO1L » ERO1L Antibodies » ERO1L Antibody

ERO1L Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ERO1L Antibody [NBP1-84799] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: ERO1L Antibody [NBP1-84799] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ERO1L Antibody [NBP1-84799] - Staining in human esophagus and skeletal muscle tissues using anti-ERO1A antibody. Corresponding ERO1A RNA-seq data are presented for the same tissues.
Western Blot: ERO1L Antibody [NBP1-84799] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ERO1L Antibody [NBP1-84799] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ERO1L Antibody [NBP1-84799] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: ERO1L Antibody [NBP1-84799] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ERO1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIY
Specificity
Specificity of human, rat ERO1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERO1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ERO1L Protein (NBP1-84799PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERO1L Antibody

  • EC 1.8.4
  • EC 1.8.4.-
  • Endoplasmic oxidoreductin-1-like protein
  • ERO1 (S. cerevisiae)-like
  • ERO1A
  • ERO1-alpha
  • ERO1L alpha
  • ERO1-l alpha
  • ERO1L
  • ERO1-L
  • ERO1-L-alpha
  • ERO1-like (S. cerevisiae)
  • ERO1-like alpha
  • ERO1-like protein alpha
  • ERO1-like
  • oxidoreductin-1-L-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Protein Disulfide
Isomerase/P4HB Antibo ...
H00005034-B01P
Western Blot: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of P4HB expression in human liver.
Immunocytochemistry/Immunofluorescence: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of purified antibody to P4HB on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of P4HB expression in HeLa.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ICC/IF
PDI Antibody (RL90)
NB300-517
Western Blot: PDI Antibody (RL90) [NB300-517] - Analysis of PDI was performed by loading 25 ug of HepG2 (Lane 1), Hela (Lane 2) and NIH-3T3 (Lane 3) cell lysates.
Immunocytochemistry/Immunofluorescence: PDI Antibody (RL90) [NB300-517] - Staining in p19 Cells.
Immunohistochemistry-Paraffin: PDI Antibody (RL90) [NB300-517] - Both normal and cancer biopsies of deparaffinized Human colon tissue tissues.
(3 Reviews)
(18 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
PADI1 Antibody
NBP2-37761
Immunocytochemistry/Immunofluorescence: PADI1 Antibody [NBP2-37761] - Staining of human cell line HaCaT shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TXNDC15 Antibody
NBP1-89394
Immunocytochemistry/Immunofluorescence: TXNDC15 Antibody [NBP1-89394] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: TXNDC15 Antibody [NBP1-89394] - Staining of human colon shows cytoplasmic positivity with a granular pattern in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
ERP44 Antibody
(3C7)
H00023071-M01
Western Blot: ERP44 Antibody (3C7) [H00023071-M01] - TXNDC4 monoclonal antibody (M01), clone 3C7 Analysis of TXNDC4 expression in K-562.
Immunohistochemistry-Paraffin: ERP44 Antibody (3C7) [H00023071-M01] - Analysis of monoclonal antibody to TXNDC4 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: ERP44 Antibody (3C7) [H00023071-M01] - TXNDC4 monoclonal antibody (M01), clone 3C7. Analysis of TXNDC4 expression in A-431.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
ERO1LB Antibody
NBP1-83961
Western Blot: ERO1LB Antibody [NBP1-83961] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: ERO1LB Antibody [NBP1-83961] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
Species: Hu
Applications: WB, IHC, IHC-P
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
Immunohistochemistry-Paraffin: GADD153/CHOP Antibody (9C8) [NB600-1335] - IHC analysis of a formalin fixed and paraffin embedded (FFPE) tissue section of mouse brain using 1:100 dilution of Calreticulin antibody. The signal was developed using HRP-DAB based detection method which followed counterstaining of the nuclei with hematoxylin. The antibody generated a cytoplasmic and nuclear staining of CHOP in various cell types in the tested section.
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Western blot analysis of GADD153/CHOP expression in HeLa cells treated with 2.5ug/ml tunicamycin for 4 hours (Lane 1) and untreated (Lane 2).
(3 Reviews)
(20 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
IRE1 alpha [p
Ser724] Antibody
NB100-2323
Western Blot: IRE1 alpha [p Ser724] Antibody [NB100-2323] - Western blot of anti-IRE1 alpha (pSer724) using Lot AN and AO of NB100-2323. HeLa cells were treated (+) or untreated (-) with 10 mM DTT for 60 min to activate the UPR. Total protein was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% BSA in TBST. The membrane was probed with 2.0 ug/ml antibody in 5% BSA, and detected with an anti-rabbit HRP secondary antibody using chemiluminecence.
Western Blot: IRE1 alpha [p Ser724] Antibody [NB100-2323] - Detection in Min6 cells which were treated with different concentrations of glucose for 3 hours prior to lysates preparation.
Western Blot: IRE1 alpha [p Ser724] Antibody [NB100-2323] - Analysis using HRP conjugate of NB100-2323. Detection of phosphorylated IRE-1 alpha using NB100-2323. Lane 1: COS-7 untransfected Lane 2: COS-7 expressing wild-type IRE1 alpha Lane 3: COS-7 expressing kinase-dead IRE1 alpha.
(4 Reviews)
(159 Publications)
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
HYPB Knockout HeLa
Cell Lysate
NBP2-65171
HYPB Knockout HeLa Cell Lysate
Species: Hu
Sirtuin 1/SIRT1
Antibody (1F3)
NBP1-51641
Western Blot: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Western blot analysis using SIRT1 mouse mAb against MCF-7 (1), Jurkat (2), Hela (3), HEK293 (4) and A549 (5) cell lysates.
Immunocytochemistry/Immunofluorescence: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - SIRT1 antibody was tested at 1:10 in Ntera2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x.
Immunohistochemistry-Paraffin: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Immunohistochemical analysis of paraffin-embedded lung cancer tissues (left) and kidney cancer tissues (right) using SIRT1 mouse mAb with DAB staining.
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
ARNT/HIF-1 beta
Antibody (H1beta234)
NB100-124
Western Blot: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - Analysis of HIF-1 beta in HeLa nuclear extract.
Immunocytochemistry/Immunofluorescence: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-HIF-1 beta (H1beta234) at 5ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - Staining of human glioblastoma multi-forme utilizing anti-HIF-1 Beta.
(1 Review)
(90 Publications)
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
ERp57/PDIA3
Antibody
NBP1-84796
Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDIA3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: ERp57/PDIA3 Antibody [NBP1-84796] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human skeletal muscle shows low expression as expected.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Peroxiredoxin 4
Antibody (OTI9A3)
NBP2-02117
Western Blot: Peroxiredoxin 4 Antibody (9A3) [NBP2-02117] - EK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Peroxiredoxin-4 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Peroxiredoxin-4.
Immunocytochemistry/Immunofluorescence: Peroxiredoxin 4 Antibody (9A3) [NBP2-02117] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Peroxiredoxin-4.
Immunohistochemistry-Paraffin: Peroxiredoxin 4 Antibody (9A3) [NBP2-02117] - Staining of paraffin-embedded Human prostate tissue using anti-Peroxiredoxin-4 mouse monoclonal antibody.
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
IP3R1 Antibody
NBP1-21398
Western Blot: IP3R1 Antibody [NBP1-21398] - Whole cell lysate from HeLa cells. Affinity purified rabbit anti-IP3R1 antibody. IP3R1 was also immunoprecipitated by rabbit anti-IP3R1 antibody NBP1-21397.
Immunohistochemistry: IP3R1 Antibody [NBP1-21398] - Sample: FFPE section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:200 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Immunohistochemistry: IP3R1 Antibody [NBP1-21398] - Sample: FFPE section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:100 (2ug/ml). Detection: Red-fluorescent Goat anti-Rabbit IgG-heavy and light chain cross-adsorbed Antibody DyLight 594 Conjugated (A120-601D4
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
ERO1L Antibody
NBP1-84799
ERO1L Antibody
Species: Hu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for ERO1L Antibody (NBP1-84799) (0)

There are no publications for ERO1L Antibody (NBP1-84799).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERO1L Antibody (NBP1-84799) (0)

There are no reviews for ERO1L Antibody (NBP1-84799). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERO1L Antibody (NBP1-84799) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERO1L Products

Bioinformatics Tool for ERO1L Antibody (NBP1-84799)

Discover related pathways, diseases and genes to ERO1L Antibody (NBP1-84799). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERO1L Antibody (NBP1-84799)

Discover more about diseases related to ERO1L Antibody (NBP1-84799).
 

Pathways for ERO1L Antibody (NBP1-84799)

View related products by pathway.

PTMs for ERO1L Antibody (NBP1-84799)

Learn more about PTMs related to ERO1L Antibody (NBP1-84799).
 

Research Areas for ERO1L Antibody (NBP1-84799)

Find related products by research area.

Blogs on ERO1L.

Check out the latest blog posts on ERO1L.
ERO1 Activity: A Potential Source of ER-Derived Oxidative Stress.
Disulfide bond formation is a pivotal step in the maturation and release of secretory proteins that are controlled by specific endoplasmic reticulum (ER) resident enzymes. An important element in this process is ERO (ER oxidoreduction), a glycosylated...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERO1L Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ERO1L
Entrez