ERO1L Antibody - BSA Free

Western Blot: ERO1L Antibody [NBP1-84799] - Analysis using Anti-ERO1A antibody NBP1-84799 (A) shows similar pattern to independent antibody NBP1-84800 (B).

Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Staining of human placenta, skeletal muscle, small intestine and squamous epithelia using Anti-ERO1A antibody HPA030053 (A) shows similar protein distribution across tissues to independent antibody HPA026653 (B).

Analysis in human esophagus and skeletal muscle tissues using HPA030053 antibody. Corresponding ERO1A RNA-seq data are presented for the same tissues.

Staining of human tonsil shows strong granular cytoplasmic positivity in squamous epithelial cells.

Staining of human esophagus shows strong granular cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ERO1L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ERO1L Antibody - BSA Free (NBP1-84799) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIY
• Predicted Species: Mouse (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERO1A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ERO1L Protein (NBP1-84799PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ERO1L Antibody - BSA Free

• EC 1.8.4
• EC 1.8.4.-
• Endoplasmic oxidoreductin-1-like protein
• ERO1 (S. cerevisiae)-like
• ERO1A
• ERO1-alpha
• ERO1L alpha
• ERO1-l alpha
• ERO1L
• ERO1-L
• ERO1-L-alpha
• ERO1-like (S. cerevisiae)
• ERO1-like alpha
• ERO1-like protein alpha
• ERO1-like
• oxidoreductin-1-L-alpha

Background

Perhaps the most distinctive feature of protein folding in the ER is the abundance of disulfide bonds that must form during maturation of proteins traveling along the secretory pathway. Formation of disulfide bonds is a redox reaction. Thus, to match the flux of disulfide bonds that exit from the ER by virtue of protein secretion, a flux of oxidizing equivalents into the ER is required. In eukaryotic cells, the essential protein relay supporting this flux, and hence disulfide bond formation, involves endoplasmic reticulum oxidoreductin 1 (Ero1) and protein disulfide isomerase (PDI). The temporal pattern of hypoxic ERO1-L alpha induction is very similar to that of genes triggered by the hypoxia inducible transcription factor (HIF-1) and is characteristically mimicked by cobalt and by deferoxamine, but is absent in cells with a defective aryl hydrocarbon receptor translocator (ARNT, HIF-1 alpha). We speculate from these findings that the expression of ERO1-L alpha is probably regulated via the HIF-pathway and thus belongs to the family of classic oxygen regulated genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERO1A