ERO1L Antibody

Images

 
Western Blot: ERO1L Antibody [NBP1-84799] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ERO1L Antibody [NBP1-84799] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Western Blot: ERO1L Antibody [NBP1-84799] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERO1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERO1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ERO1L Protein (NBP1-84799PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERO1L Antibody

  • EC 1.8.4
  • EC 1.8.4.-
  • Endoplasmic oxidoreductin-1-like protein
  • ERO1 (S. cerevisiae)-like
  • ERO1A
  • ERO1-alpha
  • ERO1-L
  • ERO1-L-alpha
  • ERO1-like (S. cerevisiae)
  • ERO1-like protein alpha
  • oxidoreductin-1-L-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00023071-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-83961
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02117
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP1-84799
Species: Hu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for ERO1L Antibody (NBP1-84799) (0)

There are no publications for ERO1L Antibody (NBP1-84799).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERO1L Antibody (NBP1-84799) (0)

There are no reviews for ERO1L Antibody (NBP1-84799). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERO1L Antibody (NBP1-84799) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERO1L Products

Bioinformatics Tool for ERO1L Antibody (NBP1-84799)

Discover related pathways, diseases and genes to ERO1L Antibody (NBP1-84799). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERO1L Antibody (NBP1-84799)

Discover more about diseases related to ERO1L Antibody (NBP1-84799).
 

Pathways for ERO1L Antibody (NBP1-84799)

View related products by pathway.

PTMs for ERO1L Antibody (NBP1-84799)

Learn more about PTMs related to ERO1L Antibody (NBP1-84799).
 

Research Areas for ERO1L Antibody (NBP1-84799)

Find related products by research area.

Blogs on ERO1L.

ERO1 Activity: A Potential Source of ER-Derived Oxidative Stress.
Disulfide bond formation is a pivotal step in the maturation and release of secretory proteins that are controlled by specific endoplasmic reticulum (ER) resident enzymes. An important element in this process is ERO (ER oxidoreduction), a glycosylated...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERO1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERO1L