ER alpha/NR3A1 Recombinant Protein Antigen

Images

 
There are currently no images for ER alpha/NR3A1 Recombinant Protein Antigen (NBP2-34478PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ER alpha/NR3A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ESR1.

Source: E. coli

Amino Acid Sequence: FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ESR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34478.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP2-34478PEP.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ER alpha/NR3A1 Recombinant Protein Antigen

  • ER alpha
  • ER
  • Era
  • ER-alpha
  • ESR1
  • ESRESRA
  • Estradiol receptor
  • estrogen receptor 1
  • estrogen receptor alpha delta 3*4,56,7*/819-2 isoform
  • estrogen receptor alpha delta 4 +49 isoform
  • estrogen receptor alpha delta 4*5,6,7*/654 isoform
  • estrogen receptor alpha
  • estrogen receptor
  • NR3A1
  • NR3A1DKFZp686N23123
  • Nuclear receptor subfamily 3 group A member 1

Background

Estrogen receptor alpha (ER alpha) is a nuclear protein and member of the steroid hormone receptor family. ER alpha possesses both DNA binding and ligand binding domains, and exerts a significant role in activating the transcription of certain genes (1). Ligand-dependent dimerization and phosphorylation on serines, 104, 106, and 118 function to regulate the transcriptional activation of ER alpha (2). The phosphorylation of the human estrogen receptor (ER) serine residue at position 118 is required for full activity of the ER activation function 1 (AF-1) (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
DY1707
Species: Hu
Applications: ELISA
NB200-305
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA

Publications for ER alpha/NR3A1 Recombinant Protein Antigen (NBP2-34478PEP)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP2-34478PEP Applications Species
Gaikwad P Construction and Performance Optimization of Bioconjugated Nanosensors for Early Detection of Breast Cancer and Pro-Inflammatory Diseases Thesis 2023-01-01

Reviews for ER alpha/NR3A1 Recombinant Protein Antigen (NBP2-34478PEP) (0)

There are no reviews for ER alpha/NR3A1 Recombinant Protein Antigen (NBP2-34478PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ER alpha/NR3A1 Recombinant Protein Antigen (NBP2-34478PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ER alpha/NR3A1 Products

Research Areas for ER alpha/NR3A1 Recombinant Protein Antigen (NBP2-34478PEP)

Find related products by research area.

Blogs on ER alpha/NR3A1

There are no specific blogs for ER alpha/NR3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ER alpha/NR3A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ESR1