Recombinant Human ER alpha/NR3A1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ER alpha/NR3A1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human ESR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ESR1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ER alpha/NR3A1 Protein

  • ER alpha
  • ER
  • Era
  • ER-alpha
  • ESR1
  • ESRESRA
  • Estradiol receptor
  • estrogen receptor 1
  • estrogen receptor alpha delta 3*4,56,7*/819-2 isoform
  • estrogen receptor alpha delta 4 +49 isoform
  • estrogen receptor alpha delta 4*5,6,7*/654 isoform
  • estrogen receptor alpha
  • estrogen receptor
  • NR3A1
  • NR3A1DKFZp686N23123
  • Nuclear receptor subfamily 3 group A member 1

Background

This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, IHC, ICC
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00002099-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01) (0)

There are no publications for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01) (0)

There are no reviews for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ER alpha/NR3A1 Products

Bioinformatics Tool for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01)

Discover related pathways, diseases and genes to ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01)

Discover more about diseases related to ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01).
 

Pathways for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01)

View related products by pathway.

PTMs for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01)

Learn more about PTMs related to ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01).
 

Research Areas for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01)

Find related products by research area.

Blogs on ER alpha/NR3A1

There are no specific blogs for ER alpha/NR3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ER alpha/NR3A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ESR1
Entrez