Recombinant Human ER alpha/NR3A1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ER alpha/NR3A1 Protein [H00002099-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human ER alpha/NR3A1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 41-140 of Human ER alpha/NR3A1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ESR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ER alpha/NR3A1 GST (N-Term) Protein

  • ER alpha
  • ER
  • Era
  • ER-alpha
  • ESR1
  • ESRESRA
  • Estradiol receptor
  • estrogen receptor 1
  • estrogen receptor alpha delta 3*4,56,7*/819-2 isoform
  • estrogen receptor alpha delta 4 +49 isoform
  • estrogen receptor alpha delta 4*5,6,7*/654 isoform
  • estrogen receptor alpha
  • estrogen receptor
  • NR3A1
  • NR3A1DKFZp686N23123
  • Nuclear receptor subfamily 3 group A member 1

Background

This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
DCRP00
Species: Hu
Applications: ELISA
NB200-305
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
1129-ER
Species: Hu
Applications: BA
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
D6050
Species: Hu
Applications: ELISA
DY262
Species: Hu
Applications: ELISA
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA

Publications for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01) (0)

There are no publications for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01) (0)

There are no reviews for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ER alpha/NR3A1 Products

Bioinformatics Tool for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01)

Discover related pathways, diseases and genes to ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01)

Discover more about diseases related to ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01).
 

Pathways for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01)

View related products by pathway.

PTMs for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01)

Learn more about PTMs related to ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01).
 

Research Areas for ER alpha/NR3A1 Partial Recombinant Protein (H00002099-Q01)

Find related products by research area.

Blogs on ER alpha/NR3A1

There are no specific blogs for ER alpha/NR3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ER alpha/NR3A1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ESR1