EPS15 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EPS15 Antibody [NBP2-68773] - Staining of human cell line U-2 OS shows localization to cytosol & vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPS15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EPS15 Antibody - BSA Free (NBP2-68773) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL
• Predicted Species: Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPS15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  EPS15 Recombinant Protein Antigen (NBP2-68773PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EPS15 Antibody - BSA Free

• AF1P
• AF-1P
• ALL1 fused gene from chromosome 1
• epidermal growth factor receptor pathway substrate 15
• epidermal growth factor receptor substrate 15
• Eps15
• MLLT5
• Protein AF-1p
• Protein Eps15

Background

EPS15 is a ubiquitously expressed protein that is involved in cell growth regulation and may be involved in the regulation of mitogenic signals and control of cell proliferation. EPS15 may be phosphorylated on tyrosine 849 following DNA damage, resulting in the internalization of EGFR. A chromosomal aberration involving EPS15 is also found in acute myelogeneous leukemias, resulting in a rogue activator protein, so EPS15 antibodies may be useful for cancer research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPS15