REPS2 Antibody - BSA Free

Immunohistochemistry: REPS2 Antibody [NBP1-80891] - DKK-1 induces ALDH1A1, REPS2 and AKR1C3 genes involved in chemotherapy detoxification. Immunohistochemical analysis of ALDH1A1, REPS2 and AKR1C3 expression in representative nuclear DKK-1-positive (strong staining) and -negative (weak staining) tumors. Scale bars: 50 um. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/3464), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: REPS2 Antibody [NBP1-80891] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

REPS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit REPS2 Antibody - BSA Free (NBP1-80891) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-REPS2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMADLPVPNQDVTSDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTPPPRPQKTHSRASSLDLN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: REPS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF and IHC reported in (PMID: 25788273).
• Control Peptide:

  REPS2 Protein (NBP1-80891PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for REPS2 Antibody - BSA Free

• partner of Ral-binding protein 1
• POB1Partner of RalBP1
• RALBP1 associated Eps domain containing 2
• ralBP1-associated Eps domain-containing protein 2
• RalBP1-interacting protein 2

Background

The product of this gene is part of a protein complex that regulates the endocytosis of growth factor receptors. The encoded protein directly interacts with a GTPase activating protein that functions downstream of the small G protein Ral. Its expression can negatively affect receptor internalization and inhibit growth factor signaling. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for REPS2 Antibody (NBP1-80891)(1)

Publication using NBP1-80891

• Aguilera O, Gonzalez-Sancho JM, Zazo S et al. Nuclear DICKKOPF-1 as a biomarker of chemoresistance and poor clinical outcome in colorectal cancer Oncotarget 2015-03-20 [PMID: 25788273] (IHC-P, ICC/IF, Human)

Bioinformatics

• Gene Symbol: REPS2
• Entrez:
  • 9185(Human)