EPS15 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EPS15 Antibody [NBP1-89221] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: EPS15 Antibody [NBP1-89221] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPS15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPS15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EPS15 Protein (NBP1-89221PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPS15 Antibody

  • AF1P
  • AF-1P
  • ALL1 fused gene from chromosome 1
  • epidermal growth factor receptor pathway substrate 15
  • epidermal growth factor receptor substrate 15
  • Eps15
  • MLLT5
  • Protein AF-1p
  • Protein Eps15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-56035
Species: Hu
Applications: WB, ICC/IF
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-88149
Species: Hu
Applications: WB, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47477
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-80891
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP1-89221
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for EPS15 Antibody (NBP1-89221) (0)

There are no publications for EPS15 Antibody (NBP1-89221).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPS15 Antibody (NBP1-89221) (0)

There are no reviews for EPS15 Antibody (NBP1-89221). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EPS15 Antibody (NBP1-89221) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPS15 Products

Bioinformatics Tool for EPS15 Antibody (NBP1-89221)

Discover related pathways, diseases and genes to EPS15 Antibody (NBP1-89221). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPS15 Antibody (NBP1-89221)

Discover more about diseases related to EPS15 Antibody (NBP1-89221).
 

Pathways for EPS15 Antibody (NBP1-89221)

View related products by pathway.

PTMs for EPS15 Antibody (NBP1-89221)

Learn more about PTMs related to EPS15 Antibody (NBP1-89221).
 

Research Areas for EPS15 Antibody (NBP1-89221)

Find related products by research area.

Blogs on EPS15

There are no specific blogs for EPS15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPS15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPS15
Entrez