EHD3 Antibody

Images

 
Western Blot: EHD3 Antibody [NBP2-31896] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human lymphoid tissues shows moderate positivity in reticular fibers in germinal center cells.
Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human liver shows moderate membranous positivity in hepatic sinusoid cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EHD3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKE
Predicted Species
Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EHD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in IHC-Frozen was reported in scientific literature (PMID: 31265809).
Control Peptide
EHD3 Protein (NBP2-31896PEP)
Publications
Read Publications using
NBP2-31896 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EHD3 Antibody

  • EH domain containing 3
  • EH domain-containing protein 3
  • EHD2
  • EH-domain containing 3
  • PAST homolog 3
  • PAST3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56035
Species: Hu
Applications: ICC/IF, KO, WB
MAB8480
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
NBP1-54873
Species: Hu, Rt
Applications: IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13723
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-82949
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-66814
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB7650
Species: Mu
Applications: IHC, WB
NBP1-93614
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3470
Species: Hu
Applications: ICC, WB
AF6116
Species: Hu
Applications: ICC, WB
NBP2-75458
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, IP, WB
NBP1-88932
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP2-31896
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for EHD3 Antibody (NBP2-31896)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-F.


Filter By Application
IHC-F
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for EHD3 Antibody (NBP2-31896) (0)

There are no reviews for EHD3 Antibody (NBP2-31896). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EHD3 Antibody (NBP2-31896) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EHD3 Products

Bioinformatics Tool for EHD3 Antibody (NBP2-31896)

Discover related pathways, diseases and genes to EHD3 Antibody (NBP2-31896). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EHD3 Antibody (NBP2-31896)

Discover more about diseases related to EHD3 Antibody (NBP2-31896).
 

Pathways for EHD3 Antibody (NBP2-31896)

View related products by pathway.

PTMs for EHD3 Antibody (NBP2-31896)

Learn more about PTMs related to EHD3 Antibody (NBP2-31896).

Blogs on EHD3

There are no specific blogs for EHD3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EHD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EHD3
Uniprot