EHD3 Antibody - BSA Free

Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human lymphoid tissues shows moderate positivity in reticular fibers in germinal center cells.

Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human liver shows moderate membranous positivity in hepatic sinusoid cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EHD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EHD3 Antibody - BSA Free (NBP2-31896) is a polyclonal antibody validated for use in IHC. Anti-EHD3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKE
• Predicted Species: Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EHD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID: 31265809)
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EHD3 Protein (NBP2-31896PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EHD3 Antibody - BSA Free

• EH domain containing 3
• EH domain-containing protein 3
• EHD2
• EH-domain containing 3
• PAST homolog 3
• PAST3

Background

The deduced protein identities between EHD1 and EHD2, between EHD1 and EHD3, and between EHD1 and EHD4, are 71%, 86%, and 76%, respectively. All contain multiple conserved regions that include a nucleotide binding consensus site at the N terminus, a bipartite nuclear localization signal, and an eps15 homology (EH) protein binding domain with an EF hand motif at the C terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EHD3 Antibody (NBP2-31896)(2)

Publications using NBP2-31896

• Li J, Geraldo LH, Dubrac A Et al. Slit2-Robo Signaling Promotes Glomerular Vascularization and Nephron Development Journal of the American Society of Nephrology : JASN 2021-09-01 [PMID: 34341180]
• Tran T, Lindstrom NO, Ransick A et al. In Vivo Developmental Trajectories of Human Podocyte Inform In Vitro Differentiation of Pluripotent Stem Cell-Derived Podocytes Dev. Cell 2019-07-01 [PMID: 31265809] (IHC-F, Human)

Bioinformatics

• Gene Symbol: EHD3
• Uniprot:
  • Q9NZN3(Human)