Ephrin-B2 Antibody - BSA Free

Ephrin-B2-Antibody-Western-Blot-NBP1-84830-img0009.jpg

Immunocytochemistry/Immunofluorescence: Ephrin-B2 Antibody [NBP1-84830] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human placenta shows moderate membranous positivity in endothelial cells.

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human colon shows weak to moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human lung shows weak to moderate membranous positivity in pneumocytes.

Western Blot: Ephrin-B2 Antibody [NBP1-84830] - Colonic levels of EphB4 & ephrin-B2 mRNA. (A) Representative agarose gels showing mRNA levels of EphB4, ephrin-B2 & GAPDH from the colon of vehicle-treated normal mice (N; n = 7) & of TNBS-treated mice administered with vehicle (CNT; n = 4) or EphB4 20 µg/kg (EphB; n = 5). Histograms represent the quantification of EphB4 (B) & ephrin-B2 (C) mRNA levels normalized to GAPDH amplification products. Transcript X1 (black bars) & transcript X2 (white bars), encoded by ephrin-B2 gene, were detected & represented (C). Data are shown as mean ± SEM. *P < 0.05 vs. N mice, one-way ANOVA followed by Bonferroni’s post-test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31297055), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Analysis in human cell line HEK 293.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ephrin-B2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EFNB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control:

  Human Artery Membrane Tissue Lysate (Adult Membrane Normal)

• Control Peptide:

  Ephrin-B2 Recombinant Protein Antigen (NBP1-84830PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 21539827). Use in Rat reported in scientific literature (PMID:28755882).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Ephrin-B2 Antibody - BSA Free

• EFNB2
• ELF-2
• ephrin B2
• EphrinB2
• Ephrin-B2
• EPLG5
• HTKL
• Htk-L
• LERK5
• LERK-5
• NLERK-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ephrin-B2 Antibody (NBP1-84830)(7)

Publications using NBP1-84830

• Aleman J, George SK, Herberg S et al. Deconstructed Microfluidic Bone Marrow On-A-Chip to Study Normal and Malignant Hemopoietic Cell-Niche Interactions Small 2019-10-01 [PMID: 31464364] (Western Blot, Mouse)
• Grandi A, Zini I, Palese S et al. Targeting the Eph/Ephrin System as Anti-Inflammatory Strategy in IBD Front. Pharmacol. 2019-06-17 [PMID: 31297055] (WB, Mouse)
• Hampton-O'Neil LA, Severn CE, Cross SJ, et al. Ephrin/Eph receptor interaction facilitates macrophage recognition of differentiating human erythroblasts Haematologica 2019-06-13 [PMID: 31197068] (WB, Human)
• Fujimoto Y, Urashima T et al. Pulmonary hypertension due to left heart disease causes intrapulmonary venous arterialization in rats. J Thorac Cardiovasc Surg 2017-01-11 [PMID: 28755882] (IF/IHC, Rat)
• Nakayama A, Nakayama M, Turner CJ et al. Ephrin-B2 controls PDGFR-beta internalization and signaling. Genes Dev 2013-12-01 [PMID: 24298057]
• Nakayama M, Nakayama A, van Lessen M et al. Spatial regulation of VEGF receptor endocytosis in angiogenesis. Nat Cell Biol 2013-03-01 [PMID: 23354168]
• Dravis C, Henkemeyer M. Ephrin-B reverse signaling controls septation events at the embryonic midline through separate tyrosine phosphorylation-independent signaling avenues Dev Biol 2011-07-01 [PMID: 21539827] (WB, Mouse)

Bioinformatics

• Gene Symbol: EFNB2