Ephrin-B2 Antibody


Western Blot: Ephrin B2 Antibody [NBP1-84830] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: Ephrin-B2 Antibody [NBP1-84830] - Ephrin B2 Antibody [NBP1-84830] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in ...read more
Immunohistochemistry-Paraffin: Ephrin B2 Antibody [NBP1-84830] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and cells in glomeruli.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Ephrin-B2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP
Specificity of human Ephrin-B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Artery Lysate (NB820-60569)
Control Peptide
Ephrin B2 Protein (NBP1-84830PEP)
Read Publications using
NBP1-84830 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23354168)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Ephrin-B2 Antibody

  • EFNB2
  • ELF-2
  • EphrinB2
  • Ephrin-B2
  • Htk-L
  • LERK-5
  • NLERK-1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB, IHC
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, ICC
Species: Hu
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Ephrin-B2 Antibody (NBP1-84830)(3)

Reviews for Ephrin-B2 Antibody (NBP1-84830) (0)

There are no reviews for Ephrin-B2 Antibody (NBP1-84830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ephrin-B2 Antibody (NBP1-84830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Ephrin-B2 Products

Bioinformatics Tool for Ephrin-B2 Antibody (NBP1-84830)

Discover related pathways, diseases and genes to Ephrin-B2 Antibody (NBP1-84830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ephrin-B2 Antibody (NBP1-84830)

Discover more about diseases related to Ephrin-B2 Antibody (NBP1-84830).

Pathways for Ephrin-B2 Antibody (NBP1-84830)

View related products by pathway.

PTMs for Ephrin-B2 Antibody (NBP1-84830)

Learn more about PTMs related to Ephrin-B2 Antibody (NBP1-84830).

Research Areas for Ephrin-B2 Antibody (NBP1-84830)

Find related products by research area.

Blogs on Ephrin-B2.

Cytokeratin 18 - A Intermediate Filament Cyotskeletal Component
Keratins, also called cytokeratins, are a family of filamentous structural proteins that form the intermediate filaments within epithelial cells. Keratins are differentially expressed depending on both the epithelial cell origin and degree of differen...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ephrin-B2 Antibody and receive a gift card or discount.


Gene Symbol EFNB2