Ephrin-A2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EFNA2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Ephrin-A2 Antibody - BSA Free
Background
The Eph subfamily represents the largest group of receptor protein kinases identified to date. There is increasing evidence that Eph family members are involved in central nervous system function and in development. Ligands for Eph receptors include ephrin-A1 (LERK-1/B61), identified as a ligand for the EphA2 (Eck) receptor; ephrin-A2 (ELF-1), identified as a ligand for the EphA3 and EphA4 (Sek) receptors; ephrin-A3 (LERK-3), identified as a ligand for EphA5 (Ehk1) and EphA3 (Hek) receptors; ephrin-A4 (LERK-4), identified as a ligand for the EphA3 receptor; ephrin-A5 (AL-1), identified as a ligand for EphA5 (REK7); ephrin-B1 (LERK-2), identified as a ligand for the EphB1 (Elk) and EphB2 (Cek5) receptors; ephrin-B2 (LERK-5), identified as a ligand for the EphB1, EphB3 (Cek10) and EphB2 receptors; and ephrin-B3 (LERK-8), identified as a ligand for EphB1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Bind
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Mu
Applications: Bind
Species: Hu
Applications: Bind
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Rt
Applications: CyTOF-ready, Flow, ICC, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Publications for Ephrin-A2 Antibody (NBP2-68860) (0)
There are no publications for Ephrin-A2 Antibody (NBP2-68860).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ephrin-A2 Antibody (NBP2-68860) (0)
There are no reviews for Ephrin-A2 Antibody (NBP2-68860).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ephrin-A2 Antibody (NBP2-68860) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ephrin-A2 Products
Blogs on Ephrin-A2