EPC2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EPC2 Antibody [NBP1-90523] - Staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: EPC2 Antibody [NBP1-90523] - Staining of human corpus, uterine shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVINKSDIKQYDFHSSDEDEFPQVLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EPC2 Protein (NBP1-90523PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPC2 Antibody

  • DKFZp566F2124
  • enhancer of polycomb homolog 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055777-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-24787
Species: Hu, Mu, Ca
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-CS, Flow-IC
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-798
Species: Hu, Mu
Applications: WB, PEP-ELISA

Publications for EPC2 Antibody (NBP1-90523) (0)

There are no publications for EPC2 Antibody (NBP1-90523).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPC2 Antibody (NBP1-90523) (0)

There are no reviews for EPC2 Antibody (NBP1-90523). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EPC2 Antibody (NBP1-90523) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPC2 Products

EPC2 NBP1-90523

Bioinformatics Tool for EPC2 Antibody (NBP1-90523)

Discover related pathways, diseases and genes to EPC2 Antibody (NBP1-90523). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPC2 Antibody (NBP1-90523)

Discover more about diseases related to EPC2 Antibody (NBP1-90523).
 

Pathways for EPC2 Antibody (NBP1-90523)

View related products by pathway.

PTMs for EPC2 Antibody (NBP1-90523)

Learn more about PTMs related to EPC2 Antibody (NBP1-90523).

Blogs on EPC2

There are no specific blogs for EPC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPC2