TOMM40 Antibody

Images

 
Western Blot: TOMM40 Antibody [NBP2-38289] - Analysis in human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: TOMM40 Antibody [NBP2-38289] - Staining of human cell line HEK 293 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human tonsil shows strong granular positivity in cytoplasm in germinal center cells.
Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human cerebral cortex shows weak granular positivity in cytoplasm in neurons.
Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human colon shows strong granular positivity in cytoplasm in glandular cells.
Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human Fallopian tube shows moderate granular positivity in cytoplasm in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TOMM40 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOMM40
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TOMM40 Protein (NBP2-38289PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOMM40 Antibody

  • C19orf1mitochondrial import receptor subunit TOM40 homolog
  • D19S1177E
  • mitochondrial outer membrane protein
  • PER-EC1
  • PEREC1Translocase of outer membrane 40 kDa subunit homolog
  • Protein Haymaker
  • TOM40p38.5
  • translocase of outer mitochondrial membrane 40 homolog (yeast)

Background

TOMM40 - translocase of outer mitochondrial membrane 40 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92298
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-80671
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-81556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, Simple Western, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
NBP1-80681
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12426
Species: Bv, Hu, Mu, Po, Pm, Rt
Applications: ELISA, IP, WB
NBP1-84509
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00010431-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00000341-M01
Species: Hu
Applications: ELISA, WB
MAB8864
Species: Hu
Applications: IHC
NBP2-44318
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-76626
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
AF5228
Species: Hu
Applications: WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-40853
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TOMM40 Antibody (NBP2-38289) (0)

There are no publications for TOMM40 Antibody (NBP2-38289).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOMM40 Antibody (NBP2-38289) (0)

There are no reviews for TOMM40 Antibody (NBP2-38289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOMM40 Antibody (NBP2-38289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOMM40 Products

Bioinformatics Tool for TOMM40 Antibody (NBP2-38289)

Discover related pathways, diseases and genes to TOMM40 Antibody (NBP2-38289). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM40 Antibody (NBP2-38289)

Discover more about diseases related to TOMM40 Antibody (NBP2-38289).
 

Pathways for TOMM40 Antibody (NBP2-38289)

View related products by pathway.

PTMs for TOMM40 Antibody (NBP2-38289)

Learn more about PTMs related to TOMM40 Antibody (NBP2-38289).
 

Research Areas for TOMM40 Antibody (NBP2-38289)

Find related products by research area.

Blogs on TOMM40

There are no specific blogs for TOMM40, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOMM40 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOMM40
Uniprot