EPB4IL2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: EPB4IL2 Antibody [NBP3-38592] - Immunofluorescence analysis of HeLa cells using EPB4IL2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Western Blot: EPB4IL2 Antibody [NBP3-38592] - Western blot analysis of various lysates using EPB4IL2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPB4IL2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human EPB4IL2 (NP_001186317.1).
  
  Sequence:
  MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGAAKRETKEVQTNELKAEKASQK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPB41L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:200 - 1:2000
• Theoretical MW: 113 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for EPB4IL2 Antibody - BSA Free

• band 4.1-like protein 2,4.1G
• DKFZp781D1972
• DKFZp781H1755,4.1-G
• erythrocyte membrane protein band 4.1 like-protein 2
• erythrocyte membrane protein band 4.1-like 2
• Generally expressed protein 4.1

Background

EPB41L2/4.1G is a member of the protein 4.1 family which includes erythroid protein 4.1 (4.1R), 4.1N (neuronal), 4.1B (brain) and 4.1G (general). The protein 4.1 family members are defined by the presence of a FERM, SAB, and CTD domain and play a role in cell membrane and cytoskeletal structural organization. EPB41L2/4.1G is widely expressed and localizes to the cytosol, perinuclear area, and centrosomes. Alternate names for EPB41L2/4.1G include erythrocyte membrane protein band 4.1-like 2, band 4.1-like protein 2, and generally expressed protein 4.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPB41L2