EPB41L1 Antibody

Images

 
Independent Antibodies: Western Blot: EPB41L1 Antibody [NBP2-31572] - Analysis using Anti-EPB41L1 antibody NBP2-31572 (A) shows similar pattern to independent antibody NBP2-31650 (B).
Immunocytochemistry/ Immunofluorescence: EPB41L1 Antibody [NBP2-31572] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human kidney.
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining in human cerebral cortex and skeletal muscle tissues using anti-EPB41L1 antibody. Corresponding EPB41L1 RNA-seq data ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human adrenal gland, cerebral cortex, colon and kidney using Anti-EPB41L1 antibody NBP2-31572 (A) shows similar ...read more
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human adrenal gland.
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPB41L1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPB41L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EPB41L1 Protein (NBP2-31572PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPB41L1 Antibody

  • band 4.1-like protein 1
  • DKFZp686H17242
  • erythrocyte membrane protein band 4.1-like 1
  • KIAA0338Neuronal protein 4.1,4.1N
  • MGC11072
  • neuron-type nonerythroid protein 4.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002035-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB110-61027
Species: Hu, Mu, Pm, Rt, Xp
Applications: Simple Western, WB
NBP1-06034
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-84597
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-52977
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-21398
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00004354-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
MAB7745
Species: Hu
Applications: IHC, KO, Simple Western, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DR2A00
Species: Hu
Applications: ELISA
DRT100
Species: Hu
Applications: ELISA
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP1-87801
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-31572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EPB41L1 Antibody (NBP2-31572) (0)

There are no publications for EPB41L1 Antibody (NBP2-31572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB41L1 Antibody (NBP2-31572) (0)

There are no reviews for EPB41L1 Antibody (NBP2-31572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EPB41L1 Antibody (NBP2-31572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPB41L1 Products

Bioinformatics Tool for EPB41L1 Antibody (NBP2-31572)

Discover related pathways, diseases and genes to EPB41L1 Antibody (NBP2-31572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPB41L1 Antibody (NBP2-31572)

Discover more about diseases related to EPB41L1 Antibody (NBP2-31572).
 

Pathways for EPB41L1 Antibody (NBP2-31572)

View related products by pathway.

PTMs for EPB41L1 Antibody (NBP2-31572)

Learn more about PTMs related to EPB41L1 Antibody (NBP2-31572).

Blogs on EPB41L1

There are no specific blogs for EPB41L1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPB41L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB41L1
Uniprot