EPB41L1 Antibody - BSA Free

Western Blot: EPB41L1 Antibody [NBP2-31572] - Analysis using Anti-EPB41L1 antibody NBP2-31572 (A) shows similar pattern to independent antibody NBP2-31650 (B).

Immunocytochemistry/Immunofluorescence: EPB41L1 Antibody [NBP2-31572] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane.

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human kidney.

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining in human cerebral cortex and skeletal muscle tissues using anti-EPB41L1 antibody. Corresponding EPB41L1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human adrenal gland, cerebral cortex, colon and kidney using Anti-EPB41L1 antibody NBP2-31572 (A) shows similar protein distribution across tissues to independent antibody NBP2-31650 (B).

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human adrenal gland.

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31572] - Staining of human colon.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPB41L1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPB41L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EPB41L1 Protein (NBP2-31572PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EPB41L1 Antibody - BSA Free

• band 4.1-like protein 1
• DKFZp686H17242
• erythrocyte membrane protein band 4.1-like 1
• KIAA0338Neuronal protein 4.1,4.1N
• MGC11072
• neuron-type nonerythroid protein 4.1

Background

Erythrocyte membrane protein band 4.1 (EPB41) is a multifunctional protein that mediates interactions between the erythrocyte cytoskeleton and the overlying plasma membrane. The protein encoded by this gene is a neuronally-enriched protein that is structurally similar to EPB41. The encoded protein binds and stabilizes D2 and D3 dopamine receptors at the neuronal plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPB41L1
• Uniprot:
  • Q9H4G0(Human)