EPB4IL2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EPB4IL2 Antibody [NBP1-90325] - Staining of human cell line U-2 OS shows localization to plasma membrane & cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EPB4IL2 Antibody [NBP1-90325] - Staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPB4IL2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPB41L2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EPB4IL2 Protein (NBP1-90325PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24381803).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EPB4IL2 Antibody - BSA Free

• band 4.1-like protein 2,4.1G
• DKFZp781D1972
• DKFZp781H1755,4.1-G
• erythrocyte membrane protein band 4.1 like-protein 2
• erythrocyte membrane protein band 4.1-like 2
• Generally expressed protein 4.1

Background

EPB41L2/4.1G is a member of the protein 4.1 family which includes erythroid protein 4.1 (4.1R), 4.1N (neuronal), 4.1B (brain) and 4.1G (general). The protein 4.1 family members are defined by the presence of a FERM, SAB, and CTD domain and play a role in cell membrane and cytoskeletal structural organization. EPB41L2/4.1G is widely expressed and localizes to the cytosol, perinuclear area, and centrosomes. Alternate names for EPB41L2/4.1G include erythrocyte membrane protein band 4.1-like 2, band 4.1-like protein 2, and generally expressed protein 4.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPB4IL2 Antibody (NBP1-90325)(3)

Publications using NBP1-90325

• Bachmann J, Burte F, Pramana S et al. Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria. PLoS Pathog 2014-04-01 [PMID: 24743550]
• Aristaeus de Asis M, Pires M, Lyon K et al. A network of spectrin and plectin surrounds the actin cuffs of apical tubulobulbar complexes in the rat. Spermatogenesis 2013-07-01 [PMID: 24381803]
• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]

Bioinformatics

• Gene Symbol: EPB41L2