Endophilin B1/Bif-1 Antibody

Images

 
Western Blot: Bif-1/Endophilin-B1 Antibody [NBP1-89973] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Bif-1/Endophilin-B1 Antibody [NBP1-89973] - Staining of human testis shows distinct cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: Bif-1/Endophilin-B1 Antibody [NBP1-89973] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-62

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Endophilin B1/Bif-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:THAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3GLB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Endophilin B1/Bif-1 Protein (NBP1-89973PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Endophilin B1/Bif-1 Antibody

  • Bax-interacting factor 1
  • Bif1
  • Bif-1
  • Bif-1dJ612B15.2
  • CGI-61
  • Endophilin B1
  • endophilin-B1
  • KIAA0491endophilin B1
  • SH3 domain-containing GRB2-like protein B1
  • SH3-containing protein SH3GLB1
  • SH3-domain GRB2-like endophilin B1
  • SH3-domain, GRB2-like, endophilin B1
  • SH3GLB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB110-87320
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1747
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89973
Species: Hu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for Bif-1/Endophilin-B1 Antibody (NBP1-89973) (0)

There are no publications for Bif-1/Endophilin-B1 Antibody (NBP1-89973).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bif-1/Endophilin-B1 Antibody (NBP1-89973) (0)

There are no reviews for Bif-1/Endophilin-B1 Antibody (NBP1-89973). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Bif-1/Endophilin-B1 Antibody (NBP1-89973) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Endophilin B1/Bif-1 Products

Bioinformatics Tool for Bif-1/Endophilin-B1 Antibody (NBP1-89973)

Discover related pathways, diseases and genes to Bif-1/Endophilin-B1 Antibody (NBP1-89973). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bif-1/Endophilin-B1 Antibody (NBP1-89973)

Discover more about diseases related to Bif-1/Endophilin-B1 Antibody (NBP1-89973).
 

Pathways for Bif-1/Endophilin-B1 Antibody (NBP1-89973)

View related products by pathway.

PTMs for Bif-1/Endophilin-B1 Antibody (NBP1-89973)

Learn more about PTMs related to Bif-1/Endophilin-B1 Antibody (NBP1-89973).

Blogs on Endophilin B1/Bif-1

There are no specific blogs for Endophilin B1/Bif-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Endophilin B1/Bif-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GLB1
Entrez