Endophilin B1/Bif-1 Antibody


Western Blot: Endophilin B1/Bif-1 Antibody [NBP1-89972] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Endophilin B1/Bif-1 Antibody [NBP1-89972] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Endophilin B1/Bif-1 Antibody [NBP1-89972] - Staining in human testis and pancreas tissues using anti-SH3GLB1 antibody. Corresponding SH3GLB1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Endophilin B1/Bif-1 Antibody [NBP1-89972] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Endophilin B1/Bif-1 Antibody [NBP1-89972] - Staining of human testis shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Endophilin B1/Bif-1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKER
Specificity of human, mouse, rat Endophilin B1/Bif-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Endophilin B1/Bif-1 Protein (NBP1-89972PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Endophilin B1/Bif-1 Antibody

  • Bax-interacting factor 1
  • Bif1
  • Bif-1
  • Bif-1dJ612B15.2
  • CGI-61
  • Endophilin B1
  • endophilin-B1
  • KIAA0491endophilin B1
  • SH3 domain-containing GRB2-like protein B1
  • SH3-containing protein SH3GLB1
  • SH3-domain GRB2-like endophilin B1
  • SH3-domain, GRB2-like, endophilin B1
  • SH3GLB1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA, RIA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for Endophilin B1/Bif-1 Antibody (NBP1-89972) (0)

There are no publications for Endophilin B1/Bif-1 Antibody (NBP1-89972).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Endophilin B1/Bif-1 Antibody (NBP1-89972) (0)

There are no reviews for Endophilin B1/Bif-1 Antibody (NBP1-89972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Endophilin B1/Bif-1 Antibody (NBP1-89972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Endophilin B1/Bif-1 Products

Bioinformatics Tool for Endophilin B1/Bif-1 Antibody (NBP1-89972)

Discover related pathways, diseases and genes to Endophilin B1/Bif-1 Antibody (NBP1-89972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endophilin B1/Bif-1 Antibody (NBP1-89972)

Discover more about diseases related to Endophilin B1/Bif-1 Antibody (NBP1-89972).

Pathways for Endophilin B1/Bif-1 Antibody (NBP1-89972)

View related products by pathway.

PTMs for Endophilin B1/Bif-1 Antibody (NBP1-89972)

Learn more about PTMs related to Endophilin B1/Bif-1 Antibody (NBP1-89972).

Blogs on Endophilin B1/Bif-1

There are no specific blogs for Endophilin B1/Bif-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Endophilin B1/Bif-1 Antibody and receive a gift card or discount.


Gene Symbol SH3GLB1