Endoglin/CD105 Recombinant Protein Antigen

Images

 
There are currently no images for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Endoglin/CD105 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Endoglin/CD105.

Source: E. coli

Amino Acid Sequence: HILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNAS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ENG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-49516.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Endoglin/CD105 Recombinant Protein Antigen

  • CD105 antigen
  • CD105
  • Endoglin
  • ENDOsler-Rendu-Weber syndrome 1
  • ENG
  • HHT1FLJ41744
  • ORW
  • ORW1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF370
Species: Hu
Applications: WB, IP
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF
NB100-77417
Species: Hu, Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NB100-65543
Species: Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
AF321
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49516PEP
Species: Hu
Applications: AC

Publications for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP) (0)

There are no publications for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP) (0)

There are no reviews for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP). (Showing 1 - 2 of 2 FAQ).

  1. I wonder if you have a CD105 or CD34 antibody suitable for IHC that is specific for human and do not bind mouse?
    • We do not have any anti-human CD34 or CD105 antibodies that are confirmed to NOT detect the mouse protein. When we have tested an antibody and confirmed that it will not react with mouse samples, we will add Mu(-) to the datasheet, and unfortunately all of our CD105 and CD34 antibodies will either detect the mouse protein, or they have not been used in mouse samples before.
  2. We are interested in CD105 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • We do not currently carry any CD105 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD105 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

Other Available Formats

Additional Endoglin/CD105 Products

Bioinformatics Tool for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP)

Discover related pathways, diseases and genes to Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP)

Discover more about diseases related to Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP).
 

Pathways for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP)

View related products by pathway.

PTMs for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP)

Learn more about PTMs related to Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP).
 

Research Areas for Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP)

Find related products by research area.

Blogs on Endoglin/CD105

There are no specific blogs for Endoglin/CD105, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Endoglin/CD105 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ENG