EN1/Engrailed 1 Antibody (3B4K8)

Western Blot: EN1/Engrailed 1 Antibody (3B4K8) [NBP3-15852] - Analysis of extracts of various cell lines, using EN1/Engrailed 1 Rabbit mAb (NBP3-15852) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Western Blot: EN1/Engrailed 1 Antibody (3B4K8) [NBP3-15852] - Analysis of extracts of SH-SY5Y cells, using EN1/Engrailed 1 Rabbit mAb (NBP3-15852) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 3B4K8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

EN1/Engrailed 1 Antibody (3B4K8) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 293-392 of human EN1/Engrailed 1 (Q05925). KLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: EN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EN1/Engrailed 1 Antibody (3B4K8)

• engrailed homeobox 1
• engrailed homolog 1
• Homeobox protein en-1
• homeobox protein engrailed-1
• hu-En-1

Background

Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EN1