ELSPBP1 Antibody


Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13958] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13958] - Staining of human epididymis shows membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13958] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13958] - Staining in human epididymis and endometrium tissues using anti-ELSPBP1 antibody. Corresponding ELSPBP1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ELSPBP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNKGSKEN LVWCATSYNYDQDHTWVYC
Specificity of human ELSPBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ELSPBP1 Protein (NBP2-13958PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ELSPBP1 Antibody

  • E12epididymal protein 12
  • EDDM12
  • Epididymal secretory protein 12
  • epididymal sperm binding protein 1
  • epididymal sperm-binding protein 1
  • HE12


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: IHC, IHC-P

Publications for ELSPBP1 Antibody (NBP2-13958) (0)

There are no publications for ELSPBP1 Antibody (NBP2-13958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELSPBP1 Antibody (NBP2-13958) (0)

There are no reviews for ELSPBP1 Antibody (NBP2-13958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ELSPBP1 Antibody (NBP2-13958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ELSPBP1 Products

Bioinformatics Tool for ELSPBP1 Antibody (NBP2-13958)

Discover related pathways, diseases and genes to ELSPBP1 Antibody (NBP2-13958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for ELSPBP1 Antibody (NBP2-13958)

Learn more about PTMs related to ELSPBP1 Antibody (NBP2-13958).

Blogs on ELSPBP1

There are no specific blogs for ELSPBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ELSPBP1 Antibody and receive a gift card or discount.


Gene Symbol ELSPBP1