eIF4E Antibody

Images

 
Western Blot: eIF4E Antibody [NBP1-57195] - C-terminal region validated by WB using Mouse Brain lysate.
Immunohistochemistry-Paraffin: eIF4E Antibody [NBP1-57195] - Human Lung respiratory epithelium tissue, 5ug/ml.
Western Blot: eIF4E Antibody [NBP1-57195]
Western Blot: eIF4E Antibody [NBP1-57195] - HEK293 lysate, mouse brain extract, Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

eIF4E Antibody Summary

Immunogen
Synthetic peptides corresponding to EIF4E(eukaryotic translation initiation factor 4E) The peptide sequence was selected from the C terminal of EIF4E. Peptide sequence TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF4E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against EIF4E and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for eIF4E Antibody

  • CBP
  • eIF4E
  • eIF-4E
  • EIF4E1
  • EIF4EL1
  • EIF4EL1MGC111573
  • eIF-4F 25 kDa subunit
  • EIF4F
  • eukaryotic translation initiation factor 4E
  • eukaryotic translation initiation factor 4E-like 1
  • mRNA cap-binding protein

Background

All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export. EIF4E is a eukaryotic translation initiation factor involved in directing ribosomes to the cap structure of mRNAs. It is a 24-kD polypeptide that exists as both a free form and as part of a multiprotein complex termed EIF4F. The EIF4E polypeptide is the rate-limiting component of the eukaryotic translation apparatus and is involved in the mRNA-ribosome binding step of eukaryotic protein synthesis. The other subunits of EIF4F are a 50-kD polypeptide, termed EIF4A (see MIM 601102), that possesses ATPase and RNA helicase activities, and a 220-kD polypeptide, EIF4G All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export. EIF4E is a eukaryotic translation initiation factor involved in directing ribosomes to the cap structure of mRNAs. It is a 24-kD polypeptide that exists as both a free form and as part of a multiprotein complex termed EIF4F. The EIF4E polypeptide is the rate-limiting component of the eukaryotic translation apparatus and is involved in the mRNA-ribosome binding step of eukaryotic protein synthesis. The other subunits of EIF4F are a 50-kD polypeptide, termed EIF4A (see MIM 601102), that possesses ATPase and RNA helicase activities, and a 220-kD polypeptide, EIF4G (MIM 600495) (Rychlik et al., 1987 [PubMed 3469651]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB200-157
Species: Hu
Applications: IHC, IHC-P, KO, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-24632
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
210-TA
Species: Hu
Applications: BA
NB100-314
Species: Hu
Applications: IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow

Publications for eIF4E Antibody (NBP1-57195) (0)

There are no publications for eIF4E Antibody (NBP1-57195).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4E Antibody (NBP1-57195) (0)

There are no reviews for eIF4E Antibody (NBP1-57195). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eIF4E Antibody (NBP1-57195) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional eIF4E Products

Bioinformatics Tool for eIF4E Antibody (NBP1-57195)

Discover related pathways, diseases and genes to eIF4E Antibody (NBP1-57195). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF4E Antibody (NBP1-57195)

Discover more about diseases related to eIF4E Antibody (NBP1-57195).
 

Pathways for eIF4E Antibody (NBP1-57195)

View related products by pathway.

PTMs for eIF4E Antibody (NBP1-57195)

Learn more about PTMs related to eIF4E Antibody (NBP1-57195).
 

Research Areas for eIF4E Antibody (NBP1-57195)

Find related products by research area.

Blogs on eIF4E

There are no specific blogs for eIF4E, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eIF4E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4E
Uniprot