EIF3D Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EIF3D Antibody [NBP2-58658] - Staining of human cell line A-431 shows localization to cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EIF3D Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDID
Specificity
Specificity of human EIF3D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF3D
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EIF3D Recombinant Protein Antigen (NBP2-58658PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EIF3D Antibody

  • eIF3d
  • eIF3-p66
  • EIF3S7eIF3 p66
  • eIF-3-zeta
  • eIF3-zeta
  • Eukaryotic translation initiation factor 3 subunit 7
  • eukaryotic translation initiation factor 3 subunit D
  • eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa
  • eukaryotic translation initiation factor 3, subunit D
  • MGC126526
  • MGC17258
  • translation initiation factor eIF3 p66 subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84869
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-16299
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
NBP1-84870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24570
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-85302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24524
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, IHC, IHC-P
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-06556
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-511
Species: Hu, Mu
Applications: WB, IP
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP2-19676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NBP1-60103
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EIF3D Antibody (NBP2-58658) (0)

There are no publications for EIF3D Antibody (NBP2-58658).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3D Antibody (NBP2-58658) (0)

There are no reviews for EIF3D Antibody (NBP2-58658). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EIF3D Antibody (NBP2-58658) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EIF3D Products

Bioinformatics Tool for EIF3D Antibody (NBP2-58658)

Discover related pathways, diseases and genes to EIF3D Antibody (NBP2-58658). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF3D Antibody (NBP2-58658)

Discover more about diseases related to EIF3D Antibody (NBP2-58658).
 

Pathways for EIF3D Antibody (NBP2-58658)

View related products by pathway.

PTMs for EIF3D Antibody (NBP2-58658)

Learn more about PTMs related to EIF3D Antibody (NBP2-58658).

Blogs on EIF3D

There are no specific blogs for EIF3D, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF3D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3D