INTS6 Antibody - BSA Free

Western Blot: INTS6 Antibody [NBP1-85302] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431

Immunocytochemistry/Immunofluorescence: INTS6 Antibody [NBP1-85302] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302] - Analysis in human testis and skeletal muscle tissues. Corresponding INTS6 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302] - Staining of human prostate shows weak nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302] - Staining of human skeletal muscle shows low positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

INTS6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit INTS6 Antibody - BSA Free (NBP1-85302) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INTS6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  INTS6 Protein (NBP1-85302PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for INTS6 Antibody - BSA Free

• DBI1
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26
• DICE1DBI-1DDX26ADDX26DEAD box protein
• DKFZp434B105
• HDB
• INT6
• integrator complex subunit 6
• Notchl2
• Protein DDX26
• Protein deleted in cancer 1
• RNA helicase HDB

Background

The tumor suppressor gene DICE1 is located within a previously reported critical region of loss of heterozygosity on chromosome 13q14.3. Expression of the remaining DICE1 allele is down-regulated in non-small cell lung carcinomas. In IGF-IR transformed Balb/c 3T3, DICE1 substantially suppressed growth in soft agar. These results demonstrate that DICE1 has a growth-suppressing activity and interferes with anchorage-independent growth of IGF-IR transformed tumor cells dependent upon IGF-I signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INTS6