EGFR Antibody

Images

 
Immunohistochemistry-Paraffin: EGFR Antibody [NBP1-84815] - EGF R/ErbB1 Antibody [NBP1-84815] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EGFR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids 344-492 from the extracellular domain of EGFR (UniProtKB - P00533): EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EGFR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EGFR Recombinant Protein Antigen (NBP1-84815PEP)
Publications
Read Publication using NBP1-84815.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23050090)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EGFR Antibody

  • avian erythroblastic leukemia viral (v-erb-b) oncogene homolog
  • cell growth inhibiting protein 40
  • cell proliferation-inducing protein 61
  • EC 2.7.10
  • EC 2.7.10.1
  • EGF R
  • EGFR
  • epidermal growth factor receptor (avian erythroblastic leukemia viral (v-erb-b)oncogene homolog)
  • epidermal growth factor receptor
  • ErbB
  • ErbB1
  • ERBB1PIG61
  • HER1
  • HER-1
  • mENA
  • Proto-oncogene c-ErbB-1
  • Receptor tyrosine-protein kinase erbB-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-46403
Species: Hu
Applications: IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for EGFR Antibody (NBP1-84815)(1)

Reviews for EGFR Antibody (NBP1-84815) (0)

There are no reviews for EGFR Antibody (NBP1-84815). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EGFR Antibody (NBP1-84815) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EGFR Products

Bioinformatics Tool for EGFR Antibody (NBP1-84815)

Discover related pathways, diseases and genes to EGFR Antibody (NBP1-84815). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGFR Antibody (NBP1-84815)

Discover more about diseases related to EGFR Antibody (NBP1-84815).
 

Pathways for EGFR Antibody (NBP1-84815)

View related products by pathway.

PTMs for EGFR Antibody (NBP1-84815)

Learn more about PTMs related to EGFR Antibody (NBP1-84815).
 

Research Areas for EGFR Antibody (NBP1-84815)

Find related products by research area.

Blogs on EGFR.

Dual applications of a c-Myc antibody in mitochondrial research
c-Myc, a proto-oncogene, has documented involvement in cellular differentiation, cell growth, cell death and tumor formation.  Target genes of the Myc family include those that participate in cell survival, translation, transcription, metabolism and...  Read full blog post.

The dynamic use of a PCNA antibody in fish, porcine and primate species
Proliferating cell nuclear antigen (PCNA) plays a crucial role in nucleic acid metabolism as it pertains to DNA replication and repair.  Most noted for its activation of subunits of DNA polymerase, it has also been found to interact with cell-cycl...  Read full blog post.

Using a STAT3 antibody in chromatin immunoprecipitation (ChIP)
Signal transducer and activator of transcription 3 (STAT3) is an important oncogenic transcriptional factor that mediates tumor induced immune suppression.  Specifically, STAT3 transmits signals from cytokines and growth factor receptors in the pla...  Read full blog post.

Beta Tubulin III and neurogenesis
Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr...  Read full blog post.

The relationship between Ki67 and HIF-1 in cancer
Ki67, also known as MKI67, is best known as the leading marker of cellular proliferation. Ki67 is regulated by a balance between synthesis and degradation, and often carries a very short half-life.  First discovered to be located to dividing cells,...  Read full blog post.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

Using EGF Protein from Novus Biologicals
EGF (epidermal growth factor) stimulates differentiation, proliferation and cell growth by binding to its receptor, EGFR. EGF was first discovered in the mouse submandibular gland in 1986 by Stanley Cohen of Vanderbilt University, leading to a Nobel P...  Read full blog post.

It's a Wiz: Merlin Antibodies Advance Hepatic Tumor Research
The NF2 gene, also known as “Merlin”, was discovered through studies into Neurofibromatosis Type II, a rare genetic disease which causes formation of non-malignant, but life-limiting, brain tumors. NF2 encodes a cytoskeletal protein involved in extrac...  Read full blog post.

The Magic of Merlin: Antibodies Point to New Role in Liver Cancer
The Merlin protein belongs to the ezrin/radixin/moesin (ERM) family of tumour suppressor proteins. Encoded by the rather less imaginatively named Neurofibromin 2 (NF2) gene, it is thought to play a role in extracellular signal transduction, linking th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EGFR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EGFR
Entrez