EGF-L6 Antibody - BSA Free

Immunohistochemistry-Paraffin: EGF-L6 Antibody [NBP2-33282] - Staining in human placenta and liver tissues using NBP2-33282 antibody. Corresponding EGFL6 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: EGF-L6 Antibody [NBP2-33282] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: EGF-L6 Antibody [NBP2-33282] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: EGF-L6 Antibody [NBP2-33282] - Staining of human placenta shows moderate membranous/ cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: EGF-L6 Antibody [NBP2-33282] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EGF-L6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EGF-L6 Antibody - BSA Free (NBP2-33282) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CSFNHGICDWKQDREDDFDWNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLVSGLCPD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EGFL6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EGF-L6 Protein (NBP2-33282PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EGF-L6 Antibody - BSA Free

• DKFZp564P2063
• EGF repeat-containing protein 6
• EGFL6
• EGF-L6
• EGF-like protein 6
• EGF-like-domain, multiple 6
• epidermal growth factor-like protein 6
• MAEG
• MAM and EGF domain containing
• MAM and EGF domains-containing gene protein
• W80

Background

The EGFL6 gene encodes an epidermal growth factor-like protein 6 with isoform 1 having 553 amino acids in length at 61 kDA and isoform 2 at 554 amino acids in length at 61 kDA. Member sof the epidermal growth factor (EGF) repeat family are known to be involved in the regulation of cell cycle, proliferation, and developmental processes. This protein encourages matrix assembly and aids in binding integrin alpha-8/beta-1, playing a role in hair follicle morphogenesis and is known to interact with genes SH3GL3 and SH3GL2. EGFL6 has been linked to detrusor sphincter dyssynergia, benign meningioma, bladder diverticulum, lung meningioma, and obesity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EGFL6
• Uniprot:
  • Q8IUX8()