EGF-L6 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit EGF-L6 Antibody - BSA Free (NBP2-33282) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: CSFNHGICDWKQDREDDFDWNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLVSGLCPD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EGFL6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%).
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for EGF-L6 Antibody - BSA Free
Background
The EGFL6 gene encodes an epidermal growth factor-like protein 6 with isoform 1 having 553 amino acids in length at 61 kDA and isoform 2 at 554 amino acids in length at 61 kDA. Member sof the epidermal growth factor (EGF) repeat family are known to be involved in the regulation of cell cycle, proliferation, and developmental processes. This protein encourages matrix assembly and aids in binding integrin alpha-8/beta-1, playing a role in hair follicle morphogenesis and is known to interact with genes SH3GL3 and SH3GL2. EGFL6 has been linked to detrusor sphincter dyssynergia, benign meningioma, bladder diverticulum, lung meningioma, and obesity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Ca, Hu, Po
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Rt
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: ELISA
Publications for EGF-L6 Antibody (NBP2-33282) (0)
There are no publications for EGF-L6 Antibody (NBP2-33282).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EGF-L6 Antibody (NBP2-33282) (0)
There are no reviews for EGF-L6 Antibody (NBP2-33282).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for EGF-L6 Antibody (NBP2-33282) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EGF-L6 Products
Research Areas for EGF-L6 Antibody (NBP2-33282)
Find related products by research area.
|
Blogs on EGF-L6