EGF-L6 Antibody

Images

 
Immunohistochemistry: EGFL6 Antibody [NBP2-33282] - Staining of human placenta shows moderate cytoplasmic positivity in stromal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EGF-L6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CSFNHGICDWKQDREDDFDWNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLVSGLCPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EGFL6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
EGF-L6 Protein (NBP2-33282PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EGF-L6 Antibody

  • DKFZp564P2063
  • EGF repeat-containing protein 6
  • EGFL6
  • EGF-L6
  • EGF-like protein 6
  • EGF-like-domain, multiple 6
  • epidermal growth factor-like protein 6
  • MAEG
  • MAM and EGF domain containing
  • MAM and EGF domains-containing gene protein
  • W80

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85452
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8025
Species: Hu, Mu
Applications: WB, IHC
AF2397
Species: Hu
Applications: WB
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF144
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB4675
Species: Mu
Applications: WB, IHC, Neut

Publications for EGF-L6 Antibody (NBP2-33282) (0)

There are no publications for EGF-L6 Antibody (NBP2-33282).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGF-L6 Antibody (NBP2-33282) (0)

There are no reviews for EGF-L6 Antibody (NBP2-33282). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EGF-L6 Antibody (NBP2-33282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EGF-L6 Products

Bioinformatics Tool for EGF-L6 Antibody (NBP2-33282)

Discover related pathways, diseases and genes to EGF-L6 Antibody (NBP2-33282). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGF-L6 Antibody (NBP2-33282)

Discover more about diseases related to EGF-L6 Antibody (NBP2-33282).
 

Pathways for EGF-L6 Antibody (NBP2-33282)

View related products by pathway.

PTMs for EGF-L6 Antibody (NBP2-33282)

Learn more about PTMs related to EGF-L6 Antibody (NBP2-33282).
 

Research Areas for EGF-L6 Antibody (NBP2-33282)

Find related products by research area.

Blogs on EGF-L6

There are no specific blogs for EGF-L6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EGF-L6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EGFL6
Entrez
Uniprot