EFEMP2 Antibody

Images

 
Western Blot: EFEMP2 Antibody [NBP1-84724] - Analysis in control (vector only transfected HEK293T lysate) and EFEMP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: EFEMP2 Antibody [NBP1-84724] - Staining of human testis shows distinct positivity in the fibrous capsule around seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EFEMP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EFEMP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EFEMP2 Protein (NBP1-84724PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EFEMP2 Antibody

  • EGF containing fibulin-like extracellular matrix protein 2
  • EGF-containing fibulin-like extracellular matrix protein 2
  • FBLN4fibulin-4
  • FIBL-4
  • fibulin 4
  • Fibulin-4
  • MBP1
  • Protein UPH1
  • UPH1mutant p53 binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
H00007702-M01
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC-P
MAB3095
Species: Hu
Applications: WB, IHC
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
AF6235
Species: Hu
Applications: WB
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AF5540
Species: Mu
Applications: WB
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43782
Species: Hu
Applications: WB
NBP1-22568
Species: Hu
Applications: IHC-P
NBP2-38047
Species: Hu
Applications: IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF2156
Species: Hu, Mu
Applications: WB, IHC

Publications for EFEMP2 Antibody (NBP1-84724) (0)

There are no publications for EFEMP2 Antibody (NBP1-84724).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EFEMP2 Antibody (NBP1-84724) (0)

There are no reviews for EFEMP2 Antibody (NBP1-84724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EFEMP2 Antibody (NBP1-84724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EFEMP2 Products

Bioinformatics Tool for EFEMP2 Antibody (NBP1-84724)

Discover related pathways, diseases and genes to EFEMP2 Antibody (NBP1-84724). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EFEMP2 Antibody (NBP1-84724)

Discover more about diseases related to EFEMP2 Antibody (NBP1-84724).
 

Pathways for EFEMP2 Antibody (NBP1-84724)

View related products by pathway.

PTMs for EFEMP2 Antibody (NBP1-84724)

Learn more about PTMs related to EFEMP2 Antibody (NBP1-84724).

Blogs on EFEMP2

There are no specific blogs for EFEMP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EFEMP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EFEMP2