Recombinant Human EEA1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human EEA1 Protein [H00008411-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human EEA1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1312-1411 of Human EEA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
EEA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EEA1 GST (N-Term) Protein

  • early endosome antigen 1
  • early endosome antigen 1, 162kD
  • early endosome-associated protein
  • EEA1
  • Endosome-associated protein p162
  • MST105
  • MSTP105
  • ZFYVE2
  • ZFYVE2MST105
  • Zinc finger FYVE domain-containing protein 2

Background

EEA1 - early endosome antigen 1, 162kD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00009146-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, RNAi, S-ELISA
NBP1-87174
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
AF1029
Species: Mu
Applications: WB, IHC, IP, ICC
NBP2-22217
Species: Hu, Mu, Ch, Rt(-)
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
H00006430-B01P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008411-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for EEA1 Partial Recombinant Protein (H00008411-Q01) (0)

There are no publications for EEA1 Partial Recombinant Protein (H00008411-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEA1 Partial Recombinant Protein (H00008411-Q01) (0)

There are no reviews for EEA1 Partial Recombinant Protein (H00008411-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EEA1 Partial Recombinant Protein (H00008411-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional EEA1 Products

Bioinformatics Tool for EEA1 Partial Recombinant Protein (H00008411-Q01)

Discover related pathways, diseases and genes to EEA1 Partial Recombinant Protein (H00008411-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEA1 Partial Recombinant Protein (H00008411-Q01)

Discover more about diseases related to EEA1 Partial Recombinant Protein (H00008411-Q01).
 

Pathways for EEA1 Partial Recombinant Protein (H00008411-Q01)

View related products by pathway.

PTMs for EEA1 Partial Recombinant Protein (H00008411-Q01)

Learn more about PTMs related to EEA1 Partial Recombinant Protein (H00008411-Q01).
 

Research Areas for EEA1 Partial Recombinant Protein (H00008411-Q01)

Find related products by research area.

Blogs on EEA1.

Understanding EEA1's Role in Membrane Endosome Fusion
EEA1, or Early Endosome Antigen 1 is a Rab5 effector essential for early endocytic membrane fusion. The EEA1 antibody is used in membrane trafficking and chaperone studies, and as an endosome marker. We at Novus Biologicals have a comprehensive antibo...  Read full blog post.

EEA1 Antibodies in Endosomal Transport and Signalling Studies
EEA1, or Early Endosome Antigen 1, is a phospholipid-binding protein essential for endosomal membrane trafficking and fusion, and is a useful endosomal marker. We at Novus Biologicals have an extensive EEA1 antibody catalog, with antibodies that have...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EEA1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EEA1