| Reactivity | Hu, Mu, HaSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 2G2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | EEA1 (NP_003557, 1312 a.a. ~ 1411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG |
| Marker | Early Endosome Marker |
| Specificity | EEA1 - early endosome antigen 1, 162kD (2G2) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | EEA1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00008411-M03 | Applications | Species |
|---|---|---|
| Pastuszka MK, Okamoto CT, Hamm-Alvarez SF, Andrew MacKay J. Flipping the Switch on Clathrin-Mediated Endocytosis using Thermally Responsive Protein Microdomains. Adv. Funct. Mater. 2014-01-01 [PMID: 25419208] |
Secondary Antibodies |
Isotype Controls |
Research Areas for EEA1 Antibody (H00008411-M03)Find related products by research area.
|
|
Understanding EEA1's Role in Membrane Endosome Fusion EEA1, or Early Endosome Antigen 1 is a Rab5 effector essential for early endocytic membrane fusion. The EEA1 antibody is used in membrane trafficking and chaperone studies, and as an endosome marker. We at Novus Biologicals have a comprehensive antibo... Read full blog post. |
|
EEA1 Antibodies in Endosomal Transport and Signalling Studies EEA1, or Early Endosome Antigen 1, is a phospholipid-binding protein essential for endosomal membrane trafficking and fusion, and is a useful endosomal marker. We at Novus Biologicals have an extensive EEA1 antibody catalog, with antibodies that have ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.