EEA1 Antibody (2G2)

Images

 
Western Blot: EEA1 Antibody (2G2) [H00008411-M03] - Analysis of EEA1 expression in A-431 (Cat # L015V1).
Immunocytochemistry/ Immunofluorescence: EEA1 Antibody (2G2) [H00008411-M03] - Analysis of monoclonal antibody to EEA1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: EEA1 Antibody (2G2) [H00008411-M03] - Detection limit for recombinant GST tagged EEA1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EEA1 Antibody (2G2) Summary

Immunogen
EEA1 (NP_003557 1312 a.a. - 1411 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Marker
Early Endosome Marker
Specificity
EEA1 - early endosome antigen 1, 162kD (2G2)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EEA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00008411-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EEA1 Antibody (2G2)

  • early endosome antigen 1
  • early endosome antigen 1, 162kD
  • early endosome-associated protein
  • EEA1
  • Endosome-associated protein p162
  • MST105
  • MSTP105
  • ZFYVE2
  • ZFYVE2MST105
  • Zinc finger FYVE domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008411-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for EEA1 Antibody (H00008411-M03)(1)

Reviews for EEA1 Antibody (H00008411-M03) (0)

There are no reviews for EEA1 Antibody (H00008411-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EEA1 Antibody (H00008411-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EEA1 Products

Bioinformatics Tool for EEA1 Antibody (H00008411-M03)

Discover related pathways, diseases and genes to EEA1 Antibody (H00008411-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEA1 Antibody (H00008411-M03)

Discover more about diseases related to EEA1 Antibody (H00008411-M03).
 

Pathways for EEA1 Antibody (H00008411-M03)

View related products by pathway.

PTMs for EEA1 Antibody (H00008411-M03)

Learn more about PTMs related to EEA1 Antibody (H00008411-M03).
 

Research Areas for EEA1 Antibody (H00008411-M03)

Find related products by research area.

Blogs on EEA1.

Understanding EEA1's Role in Membrane Endosome Fusion
EEA1, or Early Endosome Antigen 1 is a Rab5 effector essential for early endocytic membrane fusion. The EEA1 antibody is used in membrane trafficking and chaperone studies, and as an endosome marker. We at Novus Biologicals have a comprehensive antibo...  Read full blog post.

EEA1 Antibodies in Endosomal Transport and Signalling Studies
EEA1, or Early Endosome Antigen 1, is a phospholipid-binding protein essential for endosomal membrane trafficking and fusion, and is a useful endosomal marker. We at Novus Biologicals have an extensive EEA1 antibody catalog, with antibodies that have...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EEA1 Antibody (2G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol EEA1
Entrez
Uniprot