EDIL3/DEL1 Antibody - BSA Free

Staining of human cell line U2OS shows localization to plasma membrane.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EDIL3/DEL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EDIL3/DEL1 Antibody - BSA Free (NBP3-24809) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein EDIL3/DEL1 using the following amino acid sequence: QRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCEL
• Predicted Species: Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EDIL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EDIL3/DEL1 Antibody - BSA Free

• DEL1
• DEL1developmental endothelial locus-1
• Developmentally-regulated endothelial cell locus 1 protein
• EDIL3
• EGF-like repeat and discoidin I-like domain-containing protein 3
• EGF-like repeats and discoidin I-like domains 3
• Integrin-binding protein DEL1
• MGC26287

Background

Del-1 is an integrin ligand, containing an EGF-like domain, that is expressed by endothelial cells during embryological vascular development. It promotes adhesion of endothelial cells through an interaction with the alpha-v/beta-3 integrin receptor. DEL1 plays a vital role in mediating angiogenesis, and is thought to help regulate vascular morphogenesis of remodeling in embryonic development.

DEL 1 antibodies are usefull tools for angiogenesis research and endothelial cell adhesion studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EDIL3