EBI3 Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-27/IL-35 EBI3 Subunit Antibody [NBP2-48852] - Staining in human placenta and prostate tissues using anti-EBI3 antibody. Corresponding EBI3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: IL-27/IL-35 EBI3 Subunit Antibody [NBP2-48852] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: IL-27/IL-35 EBI3 Subunit Antibody [NBP2-48852] - Analysis in human placenta and prostate tissues using antibody. Corresponding EBI3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: IL-27/IL-35 EBI3 Subunit Antibody [NBP2-48852] -Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: IL-27/IL-35 EBI3 Subunit Antibody [NBP2-48852] -Staining of human duodenum shows moderate cytoplasmic positivity in goblet cells.

Immunohistochemistry-Paraffin: IL-27/IL-35 EBI3 Subunit Antibody [NBP2-48852] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EBI3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EBI3 Antibody - BSA Free (NBP2-48852) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EBI3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EBI3 Recombinant Protein Antigen (NBP2-48852PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EBI3 Antibody - BSA Free

• cytokine receptor
• EBI3
• EBI-3
• EBV-induced gene 3 protein
• Epstein-Barr virus induced 3
• Epstein-Barr virus induced gene 3
• Epstein-Barr virus-induced gene 3 protein
• IL-27 beta
• IL-27 subunit beta
• IL27B
• IL-27B
• IL35 EBI3
• IL-35 EBI3
• interleukin-27 subunit beta

Background

EBI3 gene encodes a 229 amino acid long, 25 kDA interleukin-27 subunit beta protein that is member to the hematopoitetin receptor family. These proteins obtain pro as well as anti-inflammatory properties and have roles in T-helper cell development, suppressing cell proliferation, encouraging cytotoxic T-cell activity, and can induce isotope switching in B cells. EBI3 participates in Th1 differentiation, IL-2 signaling (and its primary biological effects in various immune cells), as well as IL27-mediated signaling events. EBI3 interacts with genes IL27, IL12A, CANX, MDF1, and SMAD3. It has been associated and researched in sepsis, asthma, carcinoma, Chron's disease, b-cell lymphomas, ulcerative colitis, Hodgkin disease, lymphoma, ebv infections, and glomerulonephritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EBI3