GSTO1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Analysis in human liver and pancreas tissues using NBP2-32691 antibody. Corresponding GSTO1 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human kidney, liver, pancreas and testis using Anti-GSTO1 antibody NBP2-32691 (A) shows similar protein ...read more
Western Blot: GSTO1 Antibody [NBP2-32691] - Human breast cancer cell line MCF7 was treated with carboplatin for 72 hours and expression of GSTO1 was detected by Western blot. Image from verified customer review.
Western Blot: GSTO1 Antibody [NBP2-32691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human kidney.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human testis.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human thyroid gland.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GSTO1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. GSTO1 antibody validated for WB from a verified customer review.
Control Peptide
GSTO1 Protein (NBP2-32691PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-32691 in the following applications:

Publications
Read Publication using
NBP2-32691 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GSTO1 Antibody

  • DKFZp686H13163
  • EC 2.5.1.18
  • glutathione S-transferase omega 1
  • glutathione S-transferase omega 1-1
  • glutathione S-transferase omega-1
  • glutathione-S-transferase like
  • GSTO-1
  • GSTTLp28
  • P28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB15041
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
2526-IL/CF
Species: Hu
Applications: BA
NBP1-87431
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-59875
Species: Hu
Applications: WB
NBP2-97759
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
1887-ML/CF
Species: Mu
Applications: BA
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-27362
Species: Hu
Applications: ICC/IF, IHC, IHC-P, TCS, WB

Publications for GSTO1 Antibody (NBP2-32691)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for GSTO1 Antibody (NBP2-32691) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human and Human Cancer Cell Lines.

Reviews using NBP2-32691:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human and Human Cancer Cell Lines
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GSTO1 NBP2-32691
Enlarge
4
reviewed by:
Haiquan Lu
WB Human and Human Cancer Cell Lines 09/21/2018
View

Summary

ApplicationWestern Blot
Sample Testedbreast cancer cell line
SpeciesHuman and Human Cancer Cell Lines
LotR35363

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTO1 Antibody (NBP2-32691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTO1 Products

Bioinformatics Tool for GSTO1 Antibody (NBP2-32691)

Discover related pathways, diseases and genes to GSTO1 Antibody (NBP2-32691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTO1 Antibody (NBP2-32691)

Discover more about diseases related to GSTO1 Antibody (NBP2-32691).
 

Pathways for GSTO1 Antibody (NBP2-32691)

View related products by pathway.

PTMs for GSTO1 Antibody (NBP2-32691)

Learn more about PTMs related to GSTO1 Antibody (NBP2-32691).

Blogs on GSTO1

There are no specific blogs for GSTO1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Haiquan Lu
09/21/2018
Application: WB
Species: Human and Human Cancer Cell Lines

Bioinformatics

Gene Symbol GSTO1