Home » GSTO1 » GSTO1 Antibodies » GSTO1 Antibody

GSTO1 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: GSTO1 Antibody [NBP2-32691] - Human breast cancer cell line MCF7 was treated with carboplatin for 72 hours and expression of GSTO1 was detected by Western blot. Image from verified customer review.
Western Blot: GSTO1 Antibody [NBP2-32691] - Human breast cancer cell line MCF7 was treated with carboplatin for 72 hours and expression of GSTO1 was detected by Western blot. Image from verified customer review.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Analysis in human liver and pancreas tissues using NBP2-32691 antibody. Corresponding GSTO1 RNA-seq data are presented for the same tissues.
Western Blot: GSTO1 Antibody [NBP2-32691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human kidney.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human testis.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human thyroid gland.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human kidney, liver, pancreas and testis using Anti-GSTO1 antibody NBP2-32691 (A) shows similar protein distribution across tissues to independent ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GSTO1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Specificity
Specificity of human GSTO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. GSTO1 antibody validated for WB from a verified customer review.
Control
GSTO1 Knockout 293T Cell Lysate
Control Peptide
GSTO1 Protein (NBP2-32691PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-32691 in the following applications:
Publications
Read Publication using
NBP2-32691 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GSTO1 Antibody

  • DKFZp686H13163
  • EC 2.5.1.18
  • glutathione S-transferase omega 1
  • glutathione S-transferase omega 1-1
  • glutathione S-transferase omega-1
  • glutathione-S-transferase like
  • GSTO-1
  • GSTTLp28
  • P28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
SUB1 Antibody
NBP1-82454
Western Blot: SUB1 Antibody [NBP1-82454] - Analysis in human cell line RPMI-8226.
Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
IL-17D Antibody
(246018) [Unconjugate
MAB15041
IL‑17D was detected in immersion fixed paraffin-embedded sections of human heart using 25 µg/mL Human IL‑17D Monoclonal Antibody (Catalog # MAB15041) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the sarcoplasm of cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Human peripheral blood mononuclear cells were stained with Human IL‑17D Monoclonal Antibody (Catalog # MAB15041, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
IL-27
[Unconjugated]
2526-IL
IL-27 [Unconjugated]
(4 Reviews)
(32 Publications)
Species: Hu
SF3B14 Antibody
NBP1-87431
Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: SF3B14 Antibody [NBP1-87431] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining in human breast and skeletal muscle tissues using NBP1-87431 antibody. Corresponding SF3B6 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ROBLD3 Antibody
NBP1-71687
Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody [NBP1-71687] - ROBLD3 Antibody was tested at 1:100 in NIH/3T3 cells with FITC (green). Nuclei (Blue) were counterstained with DAPI (blue).
Immunohistochemistry: ROBLD3 Antibody [NBP1-71687] - Analysis of ROBLD3 in human renal cell carcinoma.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
S100A9 Antibody
NB110-89726
Western Blot: S100A9 Antibody [NB110-89726] - Cells were transfected with the pCMV6-ENTRY control or pCMV6-ENTRY S100A9 cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-S100A9.
Immunocytochemistry/Immunofluorescence: S100A9 Antibody [NB110-89726] - S100A9 antibody was tested in A431 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: S100A9 Antibody [NB110-89726] - Key molecules of specific signaling pathways are assayed by immunohistochemistry in the colorectum of mice. Immunohistochemistry (200x magnification) of S100a9, in normal control, IgG Ab, and anti-S100a9 Ab-treated colorectal tissues of the colitis-associated cancer mouse (n = 4). Scale bar, 50 um. Staining scores were determined by semi-quantitative optical analysis. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fimmu.2017.01774/full), licensed under a CC-BY licence.
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
RPP14 Antibody
NBP1-80965
Western Blot: RPP14 Antibody [NBP1-80965] - Analysis in control (vector only transfected HEK293T lysate) and RPP14 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: RPP14 Antibody [NBP1-80965] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RPP14 Antibody [NBP1-80965] - Staining of human kidney shows strong cytoplasmic and membranous positivity in renal tubules.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CDK2AP2 Antibody
H00010263-B01P
Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in NIH/3T3.
Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in PC-12.
Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in Hela S3 NE.
Species: Hu, Mu, Rt
Applications: WB
SLC10A7 Antibody
NBP1-59875
Western Blot: SLC10A7 Antibody [NBP1-59875] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
(1 Publication)
Species: Hu
Applications: WB
RRP4 Antibody
NBP2-20235
Western Blot: RRP4 Antibody [NBP2-20235] - Sample (30 ug of whole cell lysate) A: HCT116 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: RRP4 Antibody [NBP2-20235] - Analysis of paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: RRP4 Antibody [NBP2-20235] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:250 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
IL-23A/IL-23 P19
[Unconjugated]
1887-ML
IL-23A/IL-23 P19 [Unconjugated]
(6 Reviews)
(143 Publications)
Species: Mu
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
D4S234E Antibody
(1C3)
H00027065-M01
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3 Analysis of D4S234E expression in IMR-32.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
CDK5 Activator 1
Antibody
AF7250
CDK5 Activator 1 was detected in immersion fixed paraffin-embedded sections of human brain (cerebellum) using Sheep Anti-Human CDK5 Activator 1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7250) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent‑Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei in neuronal cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC
IL25 Antibody
[Unconjugated]
AF1147
Western blot shows lysates of Jurkat human acute T cell leukemia cell line and HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human SF20/MYDGF Antigen Affinity-purified Antibody (Catalog # AF1147) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SF20/MYDGF at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
EBI3 Antibody
(15k8D10)
NBP2-27362
Western Blot: EBI3 Antibody (15k8D10) [NBP2-27362] - Analysis of IL-35-Fc protein (A) and human Fc (B) using IL-35 antibody at 4ug/ml.
Immunohistochemistry-Paraffin: EBI3 Antibody (15k8D10) [NBP2-27362] - Formalin-fixed, paraffin-embedded human spleen (left) and lymph node metastatic malignant melanoma (right) stained with IL-35 antibody (5 ug/ml) using peroxidase-conjugate and DAB chromogen.
(11 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, TCS
GSTO1 Antibody
NBP2-32691
GSTO1 Antibody
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for GSTO1 Antibody (NBP2-32691)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for GSTO1 Antibody (NBP2-32691) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human Cancer Cell Lines and Human.

Reviews using NBP2-32691:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human Cancer Cell Lines and Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GSTO1 NBP2-32691
Enlarge 		4
reviewed by:
Anonymous
 WB Human Cancer Cell Lines and Human 09/21/2018
View

Summary

ApplicationWestern Blot
Sample Testedbreast cancer cell line
SpeciesHuman Cancer Cell Lines and Human
LotR35363

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTO1 Antibody (NBP2-32691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

GSTO1 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional GSTO1 Products

Bioinformatics Tool for GSTO1 Antibody (NBP2-32691)

Discover related pathways, diseases and genes to GSTO1 Antibody (NBP2-32691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTO1 Antibody (NBP2-32691)

Discover more about diseases related to GSTO1 Antibody (NBP2-32691).
 

Pathways for GSTO1 Antibody (NBP2-32691)

View related products by pathway.

PTMs for GSTO1 Antibody (NBP2-32691)

Learn more about PTMs related to GSTO1 Antibody (NBP2-32691).

Blogs on GSTO1

There are no specific blogs for GSTO1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Western Blot GSTO1 NBP2-32691
Enlarge
 Anonymous
09/21/2018
Application: WB
Species: Human Cancer Cell Lines and Human
read this review

Bioinformatics

Gene Symbol GSTO1