GSTO1 Antibody


Western Blot: GSTO1 Antibody [NBP2-32691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining in human liver and pancreas tissues using anti-GSTO1 antibody. Corresponding GSTO1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GSTO1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Specificity of human GSTO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
GSTO1 Lysate (NBP2-65631)
Control Peptide
GSTO1 Protein (NBP2-32691PEP)
Read Publication using
NBP2-32691 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GSTO1 Antibody

  • DKFZp686H13163
  • EC
  • glutathione S-transferase omega 1
  • glutathione S-transferase omega 1-1
  • glutathione S-transferase omega-1
  • glutathione-S-transferase like
  • GSTO-1
  • GSTTLp28
  • P28


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB
Species: Mu
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, IHC, IHC-P, TCS
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GSTO1 Antibody (NBP2-32691)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for GSTO1 Antibody (NBP2-32691) (0)

There are no reviews for GSTO1 Antibody (NBP2-32691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTO1 Antibody (NBP2-32691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional GSTO1 Products

Bioinformatics Tool for GSTO1 Antibody (NBP2-32691)

Discover related pathways, diseases and genes to GSTO1 Antibody (NBP2-32691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTO1 Antibody (NBP2-32691)

Discover more about diseases related to GSTO1 Antibody (NBP2-32691).

Pathways for GSTO1 Antibody (NBP2-32691)

View related products by pathway.

PTMs for GSTO1 Antibody (NBP2-32691)

Learn more about PTMs related to GSTO1 Antibody (NBP2-32691).

Blogs on GSTO1

There are no specific blogs for GSTO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GSTO1 Antibody and receive a gift card or discount.


Gene Symbol GSTO1