GSTO1 Antibody - BSA Free

Western Blot: GSTO1 Antibody [NBP2-32691] - Human breast cancer cell line MCF7 was treated with carboplatin for 72 hours and expression of GSTO1 was detected by Western blot. Image from verified customer review.

Western Blot: GSTO1 Antibody [NBP2-32691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Analysis in human liver and pancreas tissues. Corresponding RNA-seq data are presented for the same tissues.

Staining of human testis shows weak cytoplasmic positivity in Leydig cells as expected.

Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells as expected.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human kidney, liver, pancreas and testis HPA037603 (A) shows similar protein distribution across tissues to independent antibody HPA037604 (B).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GSTO1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSTO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. GSTO1 antibody validated for WB from a verified customer review.
• Control Peptide:

  GSTO1 Protein (NBP2-32691PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GSTO1 Antibody - BSA Free

• DKFZp686H13163
• EC 2.5.1.18
• glutathione S-transferase omega 1
• glutathione S-transferase omega 1-1
• glutathione S-transferase omega-1
• glutathione-S-transferase like
• GSTO-1
• GSTTLp28
• P28

Background

GSTO1 encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GSTO1 Antibody (NBP2-32691)(2)

Publications using NBP2-32691

• Chen W, Pilling D, Gomer RH The mRNA binding protein DDX3 mediates TGF-?1 upregulation of translation and promotes pulmonary fibrosis JCI insight 2023-02-23 [PMID: 36821384] (IHC-Fr, WB, Human, Mouse)
• Lu H, Chen I, Shimoda LA et al. Chemotherapy-Induced Ca 2+ Release Stimulates Breast Cancer Stem Cell Enrichment Cell Rep. 2017-02-21 [PMID: 28228260] (IP, WB, Human)
  
  Details:
  The positive impact of HIF inhibitors on breast cancer chemotherapy is explored through GSTO1 knockdown.

Review for GSTO1 Antibody (NBP2-32691) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human and Human Cancer Cell Lines.

reviewed by: Verified Customer WB Human and Human Cancer Cell Lines 09/21/2018

Summary

• Application: Western Blot
• Sample Tested: breast cancer cell line
• Species: Human and Human Cancer Cell Lines
• Lot: R35363

Bioinformatics

• Gene Symbol: GSTO1