Home » GSTO1 » GSTO1 Antibodies » GSTO1 Antibody

GSTO1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: GSTO1 Antibody [NBP2-32691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Western Blot: GSTO1 Antibody [NBP2-32691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining in human liver and pancreas tissues using anti-GSTO1 antibody. Corresponding GSTO1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GSTO1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Specificity
Specificity of human GSTO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
GSTO1 Lysate (NBP2-65631)
Control Peptide
GSTO1 Protein (NBP2-32691PEP)
Publications
Read Publication using
NBP2-32691 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GSTO1 Antibody

  • DKFZp686H13163
  • EC 2.5.1.18
  • glutathione S-transferase omega 1
  • glutathione S-transferase omega 1-1
  • glutathione S-transferase omega-1
  • glutathione-S-transferase like
  • GSTO-1
  • GSTTLp28
  • P28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
SUB1 Antibody
NBP1-82454
Western Blot: SUB1 Antibody [NBP1-82454] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human breast shows strong nuclear positivity in glandular cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
IL-17D Antibody
(246018) [Unconjugate
MAB15041
IL‑17D was detected in immersion fixed paraffin-embedded sections of human heart using 25 µg/mL Human IL‑17D Monoclonal Antibody (Catalog # MAB15041) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the sarcoplasm of cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Human peripheral blood mononuclear cells were stained with Human IL‑17D Monoclonal Antibody (Catalog # MAB15041, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
IL-27
[Unconjugated]
2799-ML/CF
1 μg/lane of Recombinant Mouse IL-27 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 61 kDa.
Recombinant Mouse IL-27 (Catalog # 2799‑ML/CF) demonstrates anti-viral activity in HepG2 human hepatocellular carcinoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is 0.6-6 ng/mL.
(26 Publications)
Species: Mu
SF3B14 Antibody
NBP1-87431
Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: SF3B14 Antibody [NBP1-87431] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining in human breast and skeletal muscle tissues using anti-SF3B6 antibody. Corresponding SF3B6 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ROBLD3 Antibody
NBP1-71687
Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody [NBP1-71687] - ROBLD3 Antibody was tested at 1:100 in NIH/3T3 cells with FITC (green). Nuclei (Blue) were counterstained with DAPI (blue).
Immunohistochemistry: ROBLD3 Antibody [NBP1-71687] - Analysis of ROBLD3 in human renal cell carcinoma.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
S100A9 Antibody
[Unconjugated]
AF2065
Western blot shows lysate of mouse lung tissue. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for S100A9 at approximately 14 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue and mouse spleen tissue, loaded at 0.2 mg/mL. A specific band was detected for S100A9 at approximately 20 kDa (as indicated) using 2 µg/mL of Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
S100A9 was detected in immersion fixed XB2 mouse teratoma keratinocyte cell line using 10 µg/mL Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counte­rstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(17 Publications)
Species: Mu
Applications: WB, Simple Western, IHC, ICC
RPP14 Antibody
NBP1-80965
Immunocytochemistry/Immunofluorescence: RPP14 Antibody [NBP1-80965] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RPP14 Antibody [NBP1-80965] - Staining of human kidney shows strong cytoplasmic and membranous positivity in renal tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CDK2AP2 Antibody
NBP1-91776
Western Blot: CDK2AP2 Antibody [NBP1-91776] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: CDK2AP2 Antibody [NBP1-91776] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CDK2AP2 Antibody [NBP1-91776] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SLC10A7 Antibody
NBP1-86784
Immunohistochemistry: SLC10A7 Antibody [NBP1-86784] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: IHC, IHC-P
RRP4 Antibody
NBP1-92355
Western Blot: RRP4 Antibody [NBP1-92355] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: RRP4 Antibody [NBP1-92355] - Staining of human kidney shows strong positivity in tubules.
Western Blot: RRP4 Antibody [NBP1-92355] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
IL-23A/IL-23 P19
[Unconjugated]
1887-ML
IL-23A/IL-23 P19 [Unconjugated]
(4 Reviews)
(113 Publications)
Species: Mu
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
D4S234E Antibody
(1C3)
H00027065-M01
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3 Analysis of D4S234E expression in IMR-32.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA
CDK5 Activator 1
Antibody (739304)
MAB7357
Western blot shows lysates of human brain (cortex) tissue and human brain (hippocampus) tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human CDK5 Activator 1 Monoclonal Antibody (Catalog # MAB7357) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for CDK5 Activator 1 at approximately 35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu
Applications: WB
Recombinant Mouse
IL25 Protein
NBP2-35172
SDS-Page: Mouse IL25 Protein [NBP2-35172]
Species: Mu
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - analysis of EXOSC10 in HeLa whole cell extracts treated with (1) si-control and (2) EXOSC10 siRNA using anti-EXOSC10 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
IL-27/IL-35 EBI3
Subunit Antibody (15k ...
NBP2-27362
Immunohistochemistry-Paraffin: IL-27/IL-35 EBI3 Subunit Antibody (15k8D10) [NBP2-27362] - Formalin-fixed, paraffin-embedded human spleen (left) and lymph node metastatic malignant melanoma (right) stained with IL-35 antibody (5 ug/ml) using peroxidase-conjugate and DAB chromogen.
Tissue Culture Substratum: IL-27/IL-35 EBI3 Subunit Antibody (15k8D10) [NBP2-27362] - Analysis of IL-35-Fc protein (A) and human Fc (B) using IL-35 antibody at 4ug/ml.
(7 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, TCS
GSTO1 Antibody
NBP2-32691
GSTO1 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GSTO1 Antibody (NBP2-32691)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GSTO1 Antibody (NBP2-32691) (0)

There are no reviews for GSTO1 Antibody (NBP2-32691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTO1 Antibody (NBP2-32691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

GSTO1 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional GSTO1 Products

Bioinformatics Tool for GSTO1 Antibody (NBP2-32691)

Discover related pathways, diseases and genes to GSTO1 Antibody (NBP2-32691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTO1 Antibody (NBP2-32691)

Discover more about diseases related to GSTO1 Antibody (NBP2-32691).
 

Pathways for GSTO1 Antibody (NBP2-32691)

View related products by pathway.

PTMs for GSTO1 Antibody (NBP2-32691)

Learn more about PTMs related to GSTO1 Antibody (NBP2-32691).

Blogs on GSTO1

There are no specific blogs for GSTO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTO1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GSTO1