GSTO1 Antibody

Images

 
Western Blot: GSTO1 Antibody [NBP2-32691] - Human breast cancer cell line MCF7 was treated with carboplatin for 72 hours and expression of GSTO1 was detected by Western blot. Image from verified customer review.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human testis.
Western Blot: GSTO1 Antibody [NBP2-32691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining in human liver and pancreas tissues using anti-GSTO1 antibody. Corresponding GSTO1 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human kidney, liver, testis and thyroid gland using Anti-GSTO1 antibody NBP2-32691 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human kidney.
Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691] - Staining of human thyroid gland.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GSTO1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Specificity
Specificity of human GSTO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. GSTO1 antibody validated for WB from a verified customer review.
Control
GSTO1 Knockout 293T Cell Lysate
Control Peptide
Reviewed Applications
Read 1 Review rated 4
using
NBP2-32691 in the following applications:

Publications
Read Publication using
NBP2-32691 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GSTO1 Antibody

  • DKFZp686H13163
  • EC 2.5.1.18
  • glutathione S-transferase omega 1
  • glutathione S-transferase omega 1-1
  • glutathione S-transferase omega-1
  • glutathione-S-transferase like
  • GSTO-1
  • GSTTLp28
  • P28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-59875
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
AF7250
Species: Hu
Applications: IHC
NBP2-48856
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-27362
Species: Hu
Applications: WB, IHC, IHC-P, TCS
NBP2-32691
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for GSTO1 Antibody (NBP2-32691)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for GSTO1 Antibody (NBP2-32691) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human Cancer Cell Lines and Human.

Reviews using NBP2-32691:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human Cancer Cell Lines and Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GSTO1 NBP2-32691
Enlarge
reviewed by:
Anonymous
WB Human Cancer Cell Lines and Human 09/21/2018
View

Summary

ApplicationWestern Blot
Sample Testedbreast cancer cell line
SpeciesHuman Cancer Cell Lines and Human
LotR35363

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTO1 Antibody (NBP2-32691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GSTO1 Products

Bioinformatics Tool for GSTO1 Antibody (NBP2-32691)

Discover related pathways, diseases and genes to GSTO1 Antibody (NBP2-32691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTO1 Antibody (NBP2-32691)

Discover more about diseases related to GSTO1 Antibody (NBP2-32691).
 

Pathways for GSTO1 Antibody (NBP2-32691)

View related products by pathway.

PTMs for GSTO1 Antibody (NBP2-32691)

Learn more about PTMs related to GSTO1 Antibody (NBP2-32691).

Blogs on GSTO1

There are no specific blogs for GSTO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
09/21/2018
Application: WB
Species: Human Cancer Cell Lines and Human

Bioinformatics

Gene Symbol GSTO1