Reactivity | HuSpecies Glossary |
Applications | WB, IHC, IHC-P, IP |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL |
Specificity | Specificity of human GSTO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | GSTO1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. GSTO1 antibody validated for WB from a verified customer review. |
||
Control |
|
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-32691 | Applications | Species |
---|---|---|
Lu H, Chen I, Shimoda LA et al. Chemotherapy-Induced Ca2+ Release Stimulates Breast Cancer Stem Cell Enrichment. Cell Rep. [PMID: 28228260] (WB, IP, Human) | WB, IP | Human |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
WB | Human Cancer Cell Lines and Human | 09/21/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for GSTO1 Antibody (NBP2-32691)Discover more about diseases related to GSTO1 Antibody (NBP2-32691).
| Pathways for GSTO1 Antibody (NBP2-32691)View related products by pathway.
|
PTMs for GSTO1 Antibody (NBP2-32691)Learn more about PTMs related to GSTO1 Antibody (NBP2-32691).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Anonymous 09/21/2018 |
||
Application: | WB | |
Species: | Human Cancer Cell Lines and Human |
Gene Symbol | GSTO1 |