EAAT1/GLAST-1/SLC1A3 Antibody


Immunohistochemistry: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84939] - Staining of human cerebellum shows distinct positivity in neuropil.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

EAAT1/GLAST-1/SLC1A3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84939PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EAAT1/GLAST-1/SLC1A3 Antibody

  • EA6
  • EA6FLJ25094
  • EAAT1
  • excitatory amino acid transporter 1
  • GLAST1
  • GLAST-1
  • SLC1A3
  • Sodium-dependent glutamate/aspartate transporter 1
  • solute carrier family 1 (glial high affinity glutamate transporter), member 3
  • Solute carrier family 1 member 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IP
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939) (0)

There are no publications for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939) (0)

There are no reviews for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EAAT1/GLAST-1/SLC1A3 Products

Bioinformatics Tool for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939)

Discover related pathways, diseases and genes to EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939)

Discover more about diseases related to EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939).

Pathways for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939)

View related products by pathway.

PTMs for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939)

Learn more about PTMs related to EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939).

Research Areas for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84939)

Find related products by research area.

Blogs on EAAT1/GLAST-1/SLC1A3

There are no specific blogs for EAAT1/GLAST-1/SLC1A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EAAT1/GLAST-1/SLC1A3 Antibody and receive a gift card or discount.


Gene Symbol SLC1A3