EAAT1/GLAST-1/SLC1A3 Antibody (7Y4U5) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EAAT1/GLAST-1/SLC1A3 (P43003). GTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNGVNALGLVVFS |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
SLC1A3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for EAAT1/GLAST-1/SLC1A3 Antibody (7Y4U5)
Background
Human excitatory amino acid transporters (EAATs) are members of a family of high affinity sodium-dependent transporter molecules that regulate neurotransmitter concentrations at the excitatory glutamatergic synapses of the mammalian central nervous system. It is believed that these proteins reduce extracellular glutamate concentration, thereby modulating synaptic signaling. In addition, EAATs may also be important for the prevention of glutamate excitotoxicity. EAAT1 is prominently expressed in the frontal cortex, hippocampus and basal ganglia and is also reported to be found in heart, placenta, lung and striated muscle. EAAT1 shares some pharmacological similarities with EAAT3 and both are potent antagonists that appear to specifically block transport mediated by EAAT2. EAAT1 transports L-glutamate and also L- and D-aspartate, acting as a symport by co-transporting sodium. EAAT1 is essential for terminating the postsynaptic action of glutamate, by rapidly removing released glutamate from the synaptic cleft.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, In vivo, ISH, WB
Species: Hu, Rt
Applications: ICC/IF, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for EAAT1/GLAST-1/SLC1A3 Antibody (NBP3-16865) (0)
There are no publications for EAAT1/GLAST-1/SLC1A3 Antibody (NBP3-16865).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EAAT1/GLAST-1/SLC1A3 Antibody (NBP3-16865) (0)
There are no reviews for EAAT1/GLAST-1/SLC1A3 Antibody (NBP3-16865).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EAAT1/GLAST-1/SLC1A3 Antibody (NBP3-16865) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EAAT1/GLAST-1/SLC1A3 Products
Research Areas for EAAT1/GLAST-1/SLC1A3 Antibody (NBP3-16865)
Find related products by research area.
|
Blogs on EAAT1/GLAST-1/SLC1A3