DNER Antibody

Images

 
Immunohistochemistry-Paraffin: DNER Antibody [NBP1-88665] - Staining of human cerebellum shows cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNER Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNER
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNER Protein (NBP1-88665PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-88665 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNER Antibody

  • bet
  • delta and Notch-like epidermal growth factor-related receptor
  • delta/notch-like EGF repeat containing
  • delta-notch-like EGF repeat-containing transmembrane
  • DNER
  • H_NH0150O02.1
  • UNQ26
  • WUGSC:H_NH0150O02.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-77086
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88665
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for DNER Antibody (NBP1-88665) (0)

There are no publications for DNER Antibody (NBP1-88665).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for DNER Antibody (NBP1-88665) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: IHC-Fr.

Reviews using NBP1-88665:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Fugui Li
IHC-Fr Mouse 10/06/2014
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedMouse
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNER Antibody (NBP1-88665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNER Products

Bioinformatics Tool for DNER Antibody (NBP1-88665)

Discover related pathways, diseases and genes to DNER Antibody (NBP1-88665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNER Antibody (NBP1-88665)

Discover more about diseases related to DNER Antibody (NBP1-88665).
 

Pathways for DNER Antibody (NBP1-88665)

View related products by pathway.

PTMs for DNER Antibody (NBP1-88665)

Learn more about PTMs related to DNER Antibody (NBP1-88665).
 

Research Areas for DNER Antibody (NBP1-88665)

Find related products by research area.

Blogs on DNER

There are no specific blogs for DNER, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Fugui Li
10/06/2014
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol DNER
Entrez