DNAM-1/CD226 Antibody

Images

 
Immunohistochemistry-Paraffin: DNAM-1/CD226 Antibody [NBP1-85001] - Staining of human small intestine shows positivity in lymphoid cells.
Immunohistochemistry-Paraffin: DNAM-1/CD226 Antibody [NBP1-85001] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: DNAM-1/CD226 Antibody [NBP1-85001] - Staining of human spleen shows moderate positivity in lymphoid cells.
Immunohistochemistry-Paraffin: DNAM-1/CD226 Antibody [NBP1-85001] - Staining of human tonsil shows strong positivity in lymphoid cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DNAM-1/CD226 Antibody [NBP1-85001] - Staining in human spleen and skeletal muscle tissues. Corresponding CD226 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DNAM-1/CD226 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTL
Specificity
Specificity of human DNAM-1/CD226 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD226
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAM-1/CD226 Protein (NBP1-85001PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAM-1/CD226 Antibody

  • CD226 antigenplatelet and T cell activation antigen 1
  • CD226 molecule
  • CD226
  • DNAM1
  • DNAM-1
  • DNAM1adhesion glycoprotein
  • DNAM-1DNAX accessory molecule-1
  • DNAX accessory molecule 1
  • PTA1
  • T lineage-specific activation antigen 1 antigen
  • TLiSA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
AF2229
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF1730
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2225
Species: Mu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
NBP1-27946
Species: Mu
Applications: Flow, IHC-Fr, IP, B/N
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-85001
Species: Hu
Applications: IHC, IHC-P

Publications for DNAM-1/CD226 Antibody (NBP1-85001) (0)

There are no publications for DNAM-1/CD226 Antibody (NBP1-85001).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAM-1/CD226 Antibody (NBP1-85001) (0)

There are no reviews for DNAM-1/CD226 Antibody (NBP1-85001). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAM-1/CD226 Antibody (NBP1-85001) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DNAM-1/CD226 Antibody (NBP1-85001)

Discover related pathways, diseases and genes to DNAM-1/CD226 Antibody (NBP1-85001). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAM-1/CD226 Antibody (NBP1-85001)

Discover more about diseases related to DNAM-1/CD226 Antibody (NBP1-85001).
 

Pathways for DNAM-1/CD226 Antibody (NBP1-85001)

View related products by pathway.

PTMs for DNAM-1/CD226 Antibody (NBP1-85001)

Learn more about PTMs related to DNAM-1/CD226 Antibody (NBP1-85001).

Blogs on DNAM-1/CD226

There are no specific blogs for DNAM-1/CD226, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAM-1/CD226 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD226
Entrez