DNAI1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84465] - Staining in human testis and prostate tissues using NBP1-84465 antibody. Corresponding DNAI1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84465] - Staining of human fallopian tube, placenta, prostate and testis using Anti-DNAI1 antibody NBP1-84465 (A) shows similar protein distribution across tissues to independent antibody NBP1-84466 (B).

Western Blot: DNAI1 Antibody [NBP1-84465] - Analysis in control (vector only transfected HEK293T lysate) and DNAI1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84465] - Staining of human Fallopian tube shows moderate positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84465] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84465] - Staining of human prostate shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84465] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNAI1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNAI1 Antibody - BSA Free (NBP1-84465) is a polyclonal antibody validated for use in IHC, WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAI1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DNAI1 Protein (NBP1-84465PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNAI1 Antibody - BSA Free

• Axonemal dynein intermediate chain 1
• CILD1MGC26204
• dynein intermediate chain DNAI1
• dynein, axonemal, intermediate chain 1
• dynein, axonemal, intermediate polypeptide 1
• ICS
• ICS1
• immotile cilia syndrome 1
• PCDdynein intermediate chain 1, axonemal

Background

The inner- and outer-arm dyneins, which bridge between the doublet microtubules in axonemes, are the force-generatingproteins responsible for the sliding movement in axonemes. The intermediate and light chains, thought to form the baseof the dynein arm, help mediate attachment and may also participate in regulating dynein activity. This gene encodesan intermediate chain dynein, belonging to the large family of motor proteins. Mutations in this gene result inabnormal ciliary ultrastructure and function associated with primary ciliary dyskinesia (PCD) and Kartagener syndrome.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAI1