DNA Ligase I Antibody (0D6M4)

Western Blot: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Western blot analysis of lysates from Jurkat cells, using DNA Ligase I Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded human colon carcinoma tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded rat lung tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunofluorescence analysis of C6 cells using DNA Ligase I Rabbit mAb (A9301) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded rat brain tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded human thyroid cancer tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded human spleen tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded mouse brain tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 0D6M4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

DNA Ligase I Antibody (0D6M4) Summary

• Description: Novus Biologicals Rabbit DNA Ligase I Antibody (0D6M4) (NBP3-33540) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human DNA Ligase I (P18858).
  
  Sequence:
  MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEEEDEALSPAKGQKPALDCSQVS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: LIG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 102 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DNA Ligase I Antibody (0D6M4)

• DNA ligase 1
• DNA Ligase I
• EC 6.5.1.1
• ligase I, DNA, ATP-dependent
• MGC117397
• MGC130025
• Polydeoxyribonucleotide synthase [ATP] 1
• polydeoxyribonucleotide synthase ATP 1

Background

DNA ligase 1 catalyzes the joining of double-stranded DNA ends during replication, recombination, and repair. Structurally, DNA ligase 1 is toroidal and encircles nicked DNA substrates. The 9-1-1 complex, a DNA damage checkpoint complex, has been reported to associate with DNA ligase 1 and stimulate ligase activity. Mutations in DNA ligase 1 result in immunodeficiency and increased sensitivity to DNA-damaging agents.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LIG1