DLG7/HURP Antibody

Images

 
Orthogonal Strategies: Western Blot: DLG7/HURP Antibody [NBP1-87976] - Analysis in human cell lines U2OS and SK-MEL-30 using anti-DLGAP5 antibody. Corresponding DLGAP5 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: DLG7/HURP Antibody [NBP1-87976] - Staining of human cell line A-431 shows localization to cytosol & microtubule organizing center. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining in human testis and pancreas tissues using anti-DLGAP5 antibody. Corresponding DLGAP5 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DLG7/HURP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAE
Specificity
Specificity of human DLG7/HURP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLGAP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DLG7/HURP Protein (NBP1-87976PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DLG7/HURP Antibody

  • DAP-5
  • Discs large homolog 7
  • discs, large (Drosophila) homolog-associated protein 5
  • disks large-associated protein 5
  • DLG7
  • Hepatoma up-regulated protein
  • HURPDLG1
  • KIAA0008discs, large homolog 7 (Drosophila)
  • large homolog 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61832
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB100-79814
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6000
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00025793-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87976
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DLG7/HURP Antibody (NBP1-87976) (0)

There are no publications for DLG7/HURP Antibody (NBP1-87976).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLG7/HURP Antibody (NBP1-87976) (0)

There are no reviews for DLG7/HURP Antibody (NBP1-87976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DLG7/HURP Antibody (NBP1-87976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DLG7/HURP Products

Bioinformatics Tool for DLG7/HURP Antibody (NBP1-87976)

Discover related pathways, diseases and genes to DLG7/HURP Antibody (NBP1-87976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLG7/HURP Antibody (NBP1-87976)

Discover more about diseases related to DLG7/HURP Antibody (NBP1-87976).
 

Pathways for DLG7/HURP Antibody (NBP1-87976)

View related products by pathway.

PTMs for DLG7/HURP Antibody (NBP1-87976)

Learn more about PTMs related to DLG7/HURP Antibody (NBP1-87976).
 

Research Areas for DLG7/HURP Antibody (NBP1-87976)

Find related products by research area.

Blogs on DLG7/HURP

There are no specific blogs for DLG7/HURP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLG7/HURP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLGAP5