DLEU1 Antibody (2C2) - Azide and BSA Free Summary
Immunogen |
DLEU1 (AAH20692, 1 a.a. ~ 78 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY |
Specificity |
DLEU1 - deleted in lymphocytic leukemia, 1 (2C2) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
DLEU1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DLEU1 Antibody (2C2) - Azide and BSA Free
Background
DLEU1 may act as a tumor suppressor
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: ChHa, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: BA
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, KD, WB
Species: Hu
Applications: ICC, Simple Western, WB
Publications for DLEU1 Antibody (H00010301-M02) (0)
There are no publications for DLEU1 Antibody (H00010301-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DLEU1 Antibody (H00010301-M02) (0)
There are no reviews for DLEU1 Antibody (H00010301-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DLEU1 Antibody (H00010301-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DLEU1 Products
Research Areas for DLEU1 Antibody (H00010301-M02)
Find related products by research area.
|
Blogs on DLEU1