Dihydrolipoamide Dehydrogenase/DLD Recombinant Protein Antigen

Images

 
There are currently no images for Dihydrolipoamide Dehydrogenase/DLD Protein (NBP2-13926PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dihydrolipoamide Dehydrogenase/DLD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DLD.

Source: E. coli

Amino Acid Sequence: DVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DLD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13926.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dihydrolipoamide Dehydrogenase/DLD Recombinant Protein Antigen

  • 2-oxo-glutarate complex, branched chain keto acid dehydrogenase complex)
  • branched chain keto acid dehydrogenase complex
  • Diaphorase
  • dihydrolipoamide dehydrogenase (E3 component of pyruvate dehydrogenase complex
  • Dihydrolipoamide Dehydrogenase
  • dihydrolipoamide dehydrogenasemitochondrial
  • DLD
  • DLDD
  • DLDH
  • E3 component of pyruvate dehydrogenase complex, 2-oxo-glutarate complex
  • E3
  • EC 1.8.1
  • EC 1.8.1.4
  • GCSL
  • Glycine cleavage system L protein
  • glycine cleavage system protein L
  • LAD
  • Lipoamide Dehydrogenase
  • lipoamide reductase
  • lipoyl dehydrogenase
  • PHE3

Background

Lipoamide Dehydrogenase encodes the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-84943
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00009354-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
255-SC
Species: Hu
Applications: BA
MAB2476
Species: Hu
Applications: IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, RNAi, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-13926PEP
Species: Hu
Applications: AC

Publications for Dihydrolipoamide Dehydrogenase/DLD Protein (NBP2-13926PEP) (0)

There are no publications for Dihydrolipoamide Dehydrogenase/DLD Protein (NBP2-13926PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dihydrolipoamide Dehydrogenase/DLD Protein (NBP2-13926PEP) (0)

There are no reviews for Dihydrolipoamide Dehydrogenase/DLD Protein (NBP2-13926PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dihydrolipoamide Dehydrogenase/DLD Protein (NBP2-13926PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dihydrolipoamide Dehydrogenase/DLD Products

Research Areas for Dihydrolipoamide Dehydrogenase/DLD Protein (NBP2-13926PEP)

Find related products by research area.

Blogs on Dihydrolipoamide Dehydrogenase/DLD

There are no specific blogs for Dihydrolipoamide Dehydrogenase/DLD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dihydrolipoamide Dehydrogenase/DLD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DLD