DFF45/ICAD Antibody - BSA Free

Immunohistochemistry-Paraffin: DFF45/ICAD Antibody [NBP1-85249] - Staining of human urinary bladder shows nuclear positivity in urothelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DFF45/ICAD Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DFF45/ICAD Antibody - BSA Free (NBP1-85249) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DFFA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DFF45/ICAD Protein (NBP1-85249PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DFF45/ICAD Antibody - BSA Free

• DFF1
• DFF1DNA fragmentation factor 45 kDa subunit
• DFF45
• DFF45DNA fragmentation factor subunit alpha
• DFF-45DNA fragmentation factor, 45 kD, alpha polypeptide
• DFFA
• DNA fragmentation factor, 45kDa, alpha polypeptide
• ICAD
• Inhibitor of CAD

Background

Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DFFA