Desmoglein-1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EPVPECSDGAIHSWAVEGPQPEPRDITTVIPQIPPDNANIIECIDNSGVYTNEYGGREMQDLGGGERMTGFELTEGVKTSGMPEICQEYSG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DSG1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Desmoglein-1 Antibody - BSA Free
Background
Desmosomes are cell-cell junctions between epithelial, myocardial and certain other cell types. Desmoglein 1 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. Desmoglein 1 has been identified as the autoantigen of the autoimmune skin blistering disease pemphigus foliaceus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: DB, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western
Species: Mu
Applications: IHC
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Bv, Ca, Ch, Fe, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC-P, WB
Publications for Desmoglein-1 Antibody (NBP3-17012) (0)
There are no publications for Desmoglein-1 Antibody (NBP3-17012).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Desmoglein-1 Antibody (NBP3-17012) (0)
There are no reviews for Desmoglein-1 Antibody (NBP3-17012).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Desmoglein-1 Antibody (NBP3-17012) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Desmoglein-1 Products
Research Areas for Desmoglein-1 Antibody (NBP3-17012)
Find related products by research area.
|
Blogs on Desmoglein-1