Collagen XVII Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Collagen XVII Antibody [NBP1-91800] - Analysis in human skin and liver tissues. Corresponding COL17A1 RNA-seq data are represented for the same tissues.
Orthogonal Strategies: Western Blot: Collagen XVII Antibody [NBP1-91800] - Analysis in human cell lines A-431 and MCF-7 using anti-COL17A1 antibody. Corresponding COL17A1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Collagen XVII Antibody [NBP1-91800] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Collagen XVII Antibody [NBP1-91800] - Staining of human skin shows moderate membranous positivity in basal layer of epidermal cells.
Immunohistochemistry-Paraffin: Collagen XVII Antibody [NBP1-91800] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Collagen XVII Antibody [NBP1-91800] - Staining of human endometrium shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Collagen XVII Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL17A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Collagen XVII Protein (NBP1-91800PEP)
Publications
Read Publications using NBP1-91800.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Collagen XVII Antibody

  • 180 kDa bullous pemphigoid antigen 2
  • BA16H23.2
  • BP180
  • BP180alpha 1 type XVII collagen
  • BPA-2
  • BPAG2
  • BPAG2bA16H23.2 (collagen, type XVII, alpha 1 (BP180))
  • bullous pemphigoid antigen 2 (180kD)
  • Bullous pemphigoid antigen 2
  • COL17A1
  • Collagen 17
  • collagen alpha-1(XVII) chain
  • Collagen XVII
  • collagen XVII, alpha-1 polypeptide
  • collagen, type XVII, alpha 1
  • Collagen-17
  • ERED
  • FLJ60881
  • KIAA0204
  • LAD-1

Background

Collagen XVII encodes the alpha chain of type XVII collagen. Unlike most collagens, collagen XVII is a transmembrane protein. Collagen XVII is a structural component of hemidesmosomes, multiprotein complexes at the dermal-epidermal basement membrane zone that mediate adhesion of keratinocytes to the underlying membrane. Mutations in this gene are associated with both generalized atrophic benign and junctional epidermolysis bullosa. Two homotrimeric forms of type XVII collagen exist. The full length form is the transmembrane protein. A soluble form, referred to as either ectodomain or LAD-1, is generated by proteolytic processing of the full length form. [provided by RefSeq]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Collagen XVII Antibody (NBP1-91800)(2)

Reviews for Collagen XVII Antibody (NBP1-91800) (0)

There are no reviews for Collagen XVII Antibody (NBP1-91800). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen XVII Antibody (NBP1-91800) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen XVII Products

Research Areas for Collagen XVII Antibody (NBP1-91800)

Find related products by research area.

Blogs on Collagen XVII

There are no specific blogs for Collagen XVII, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen XVII Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL17A1