Collagen XVII Antibody

Images

 
Orthogonal Strategies: Western Blot: Collagen XVII Antibody [NBP1-91800] - Analysis in human cell lines A-431 and MCF-7 using anti-COL17A1 antibody. Corresponding COL17A1 RNA-seq data are presented for the same ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Collagen XVII Antibody [NBP1-91800] - Staining in human skin and skeletal muscle tissues using anti-COL17A1 antibody. Corresponding COL17A1 RNA-seq data are ...read more
Western Blot: Collagen XVII Antibody [NBP1-91800] - Analysis in human cell line BEWO.
Immunohistochemistry-Paraffin: Collagen XVII Antibody [NBP1-91800] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Collagen XVII Antibody [NBP1-91800] - Staining of human skin shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Collagen XVII Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR
Specificity
Specificity of human Collagen XVII antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL17A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Collagen XVII Protein (NBP1-91800PEP)
Publications
Read Publication using NBP1-91800.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23624916)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Collagen XVII Antibody

  • 180 kDa bullous pemphigoid antigen 2
  • BA16H23.2
  • BP180
  • BP180alpha 1 type XVII collagen
  • BPA-2
  • BPAG2
  • BPAG2bA16H23.2 (collagen, type XVII, alpha 1 (BP180))
  • bullous pemphigoid antigen 2 (180kD)
  • Bullous pemphigoid antigen 2
  • COL17A1
  • Collagen 17
  • collagen alpha-1(XVII) chain
  • Collagen XVII
  • collagen XVII, alpha-1 polypeptide
  • collagen, type XVII, alpha 1
  • Collagen-17
  • ERED
  • FLJ60881
  • KIAA0204
  • LAD-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDX0450P-100
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1730
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-78984
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC
NBP1-84567
Species: Hu
Applications: IHC, IHC-P
NBP1-85945
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-46622
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-91800
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Collagen XVII Antibody (NBP1-91800)(1)

Reviews for Collagen XVII Antibody (NBP1-91800) (0)

There are no reviews for Collagen XVII Antibody (NBP1-91800). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen XVII Antibody (NBP1-91800) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Collagen XVII Antibody (NBP1-91800)

Discover related pathways, diseases and genes to Collagen XVII Antibody (NBP1-91800). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen XVII Antibody (NBP1-91800)

Discover more about diseases related to Collagen XVII Antibody (NBP1-91800).
 

Pathways for Collagen XVII Antibody (NBP1-91800)

View related products by pathway.

PTMs for Collagen XVII Antibody (NBP1-91800)

Learn more about PTMs related to Collagen XVII Antibody (NBP1-91800).

Blogs on Collagen XVII

There are no specific blogs for Collagen XVII, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen XVII Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL17A1
Entrez