Deleted In Lymphocytic Leukemia, 7 Antibody

Images

 
Immunohistochemistry: Deleted In Lymphocytic Leukemia, 7 Antibody [NBP2-30666] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Deleted In Lymphocytic Leukemia, 7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VVDSTSELVSVEQTLLGPLQQERSFPIHLKDSVEFRNICSHLALQIEGQQFDRDLNAAHQCLKTIVKKLIQSLANFP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLEU7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Deleted In Lymphocytic Leukemia, 7 Protein (NBP2-30666PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Deleted In Lymphocytic Leukemia, 7 Antibody

  • Deleted In Lymphocytic Leukemia 7
  • DLEU7
  • LEU7
  • Leukemia-Associated Protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666) (0)

There are no publications for Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666) (0)

There are no reviews for Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Deleted In Lymphocytic Leukemia, 7 Products

Bioinformatics Tool for Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666)

Discover related pathways, diseases and genes to Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666)

Discover more about diseases related to Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666).
 

Pathways for Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666)

View related products by pathway.

PTMs for Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666)

Learn more about PTMs related to Deleted In Lymphocytic Leukemia, 7 Antibody (NBP2-30666).

Blogs on Deleted In Lymphocytic Leukemia, 7

There are no specific blogs for Deleted In Lymphocytic Leukemia, 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Deleted In Lymphocytic Leukemia, 7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLEU7
Uniprot