Decorin Antibody

Images

 
Western Blot: Decorin Antibody [NBP2-56346] - Western blot analysis in control (vector only transfected HEK293T lysate) and DCN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Decorin Antibody [NBP2-56346] - Staining in human ovary and cerebral cortex tissues using anti-DCN antibody. Corresponding DCN RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: Decorin Antibody [NBP2-56346] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Decorin Antibody [NBP2-56346] - Staining of human ovary shows high expression.
Immunohistochemistry: Decorin Antibody [NBP2-56346] - Immunohistochemical staining of human ovary shows extracellular positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Decorin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY
Specificity
Specificity of human Decorin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Decorin Recombinant Protein Antigen (NBP2-56346PEP)

Reactivity Notes

Mouse 82%, Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Decorin Antibody

  • Bone proteoglycan II
  • CSCD
  • DCN
  • decorin proteoglycan
  • Decorin
  • dermatan sulphate proteoglycans II
  • DSPG2
  • PG40
  • PGII
  • PG-II
  • PGS2
  • PG-S2
  • proteoglycan core protein
  • SLRR1B
  • SLRR1BPGS2
  • small leucine-rich protein 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85432
Species: Hu
Applications: IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB5945
Species: Hu
Applications: WB
AF2846
Species: Hu
Applications: WB, IHC
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Decorin Antibody (NBP2-56346) (0)

There are no publications for Decorin Antibody (NBP2-56346).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Decorin Antibody (NBP2-56346) (0)

There are no reviews for Decorin Antibody (NBP2-56346). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Decorin Antibody (NBP2-56346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Decorin Products

Bioinformatics Tool for Decorin Antibody (NBP2-56346)

Discover related pathways, diseases and genes to Decorin Antibody (NBP2-56346). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Decorin Antibody (NBP2-56346)

Discover more about diseases related to Decorin Antibody (NBP2-56346).
 

Pathways for Decorin Antibody (NBP2-56346)

View related products by pathway.

PTMs for Decorin Antibody (NBP2-56346)

Learn more about PTMs related to Decorin Antibody (NBP2-56346).
 

Research Areas for Decorin Antibody (NBP2-56346)

Find related products by research area.

Blogs on Decorin

There are no specific blogs for Decorin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Decorin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCN