Reactivity | Hu, CaSpecies Glossary |
Applications | WB, ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Concentration | 0.5 mg/ml |
Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | Synthetic peptides corresponding to DCN(decorin) The peptide sequence was selected from the N terminal of DCN. Peptide sequence IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | DCN |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This Decorin Antibody is validated for ICC/IF from a verified customer review. |
|
Theoretical MW | 36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Publication using NBP1-57923 | Applications | Species |
---|---|---|
Erwin WM, DeSouza L, Funabashi M et al. The biological basis of degenerative disc disease: proteomic and biomechanical analysis of the canine intervertebral disc. Arthritis Res. Ther. 2015-09-05 [PMID: 26341258] (WB, Canine) | WB | Canine |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Catherine Heyward |
ICC | Human | 07/29/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Decorin Antibody (NBP1-57923)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.