Decorin Antibody

Images

 
Western Blot: Decorin Antibody [NBP1-57923] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta
Immunohistochemistry-Paraffin: Decorin Antibody [NBP1-57923] - Human skin tissue at an antibody concentration of 4-8ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Gt, Rb, ShSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Decorin Antibody Summary

Immunogen
Synthetic peptides corresponding to DCN(decorin) The peptide sequence was selected from the N terminal of DCN. Peptide sequence IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against DCN and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-57923 in the following applications:

  • WB
    1 publication

Reactivity Notes

Canine reactivity reported in scientific literature (PMID: 26341258).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Decorin Antibody

  • Bone proteoglycan II
  • CSCD
  • DCN
  • decorin proteoglycan
  • Decorin
  • dermatan sulphate proteoglycans II
  • DSPG2
  • PG40
  • PGII
  • PG-II
  • PGS2
  • PG-S2
  • proteoglycan core protein
  • SLRR1B
  • SLRR1BPGS2
  • small leucine-rich protein 1B

Background

DCN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. This protein and biglycan are thought to be the result of a gene duplication. DCN is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. The encoded protein and biglycan are thought to be the result of a gene duplication. This protein is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85432
Species: Hu
Applications: IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF5945
Species: Hu, Mu, Rt
Applications: WB
AF2846
Species: Hu
Applications: WB, IHC
NBP2-58327
Species: Hu
Applications: WB, ICC/IF
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80972
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55231
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Decorin Antibody (NBP1-57923)(1)

We have publications tested in 1 confirmed species: Canine.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Canine
(1)
All Species

Reviews for Decorin Antibody (NBP1-57923) (0)

There are no reviews for Decorin Antibody (NBP1-57923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Decorin Antibody (NBP1-57923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Decorin Products

Bioinformatics Tool for Decorin Antibody (NBP1-57923)

Discover related pathways, diseases and genes to Decorin Antibody (NBP1-57923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Decorin Antibody (NBP1-57923)

Discover more about diseases related to Decorin Antibody (NBP1-57923).
 

Pathways for Decorin Antibody (NBP1-57923)

View related products by pathway.

PTMs for Decorin Antibody (NBP1-57923)

Learn more about PTMs related to Decorin Antibody (NBP1-57923).
 

Research Areas for Decorin Antibody (NBP1-57923)

Find related products by research area.

Blogs on Decorin

There are no specific blogs for Decorin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Decorin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCN
Uniprot