DEC-205/CD205 Antibody


Immunocytochemistry/ Immunofluorescence: Renal Cell Carcinoma (gp200) Antibody [NBP2-58339] - Staining of human cell line CACO-2 shows localization to the Golgi apparatus.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

DEC-205/CD205 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QRHRLHLAGFSSVRYAQGVNEDEIMLPSFH
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Renal Cell Carcinoma (gp200) Recombinant Protein Antigen (NBP2-58339PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for DEC-205/CD205 Antibody

  • CD205
  • DEC205
  • DEC-205
  • Ly75


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DEC-205/CD205 Antibody (NBP2-58339) (0)

There are no publications for DEC-205/CD205 Antibody (NBP2-58339).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEC-205/CD205 Antibody (NBP2-58339) (0)

There are no reviews for DEC-205/CD205 Antibody (NBP2-58339). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DEC-205/CD205 Antibody (NBP2-58339) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DEC-205/CD205 Products

Bioinformatics Tool for DEC-205/CD205 Antibody (NBP2-58339)

Discover related pathways, diseases and genes to DEC-205/CD205 Antibody (NBP2-58339). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for DEC-205/CD205 Antibody (NBP2-58339)

Find related products by research area.

Blogs on DEC-205/CD205

There are no specific blogs for DEC-205/CD205, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DEC-205/CD205 Antibody and receive a gift card or discount.


Gene Symbol LY75