DDX5 Antibody

Images

 
Western Blot: DDX5 Antibody [NBP1-83406] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: DDX5 Antibody [NBP1-83406] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DDX5 Antibody [NBP1-83406] - Staining of human colon shows strong nuclear positivity in glandular cells.
Western Blot: DDX5 Antibody [NBP1-83406] - Analysis in human cell line MOLT-4.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX5 Protein (NBP1-83406PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX5 Antibody

  • B-cell CLL/lymphoma 7 protein family member C
  • B-cell CLL/lymphoma 7C
  • DDX5
  • DEAD/H
  • G17P1
  • HELR
  • HLR1
  • HUMP68

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-352
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
H00054606-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-47256
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF4385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DDX5 Antibody (NBP1-83406) (0)

There are no publications for DDX5 Antibody (NBP1-83406).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX5 Antibody (NBP1-83406) (0)

There are no reviews for DDX5 Antibody (NBP1-83406). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX5 Antibody (NBP1-83406) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX5 Products

Bioinformatics Tool for DDX5 Antibody (NBP1-83406)

Discover related pathways, diseases and genes to DDX5 Antibody (NBP1-83406). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX5 Antibody (NBP1-83406)

Discover more about diseases related to DDX5 Antibody (NBP1-83406).
 

Pathways for DDX5 Antibody (NBP1-83406)

View related products by pathway.

PTMs for DDX5 Antibody (NBP1-83406)

Learn more about PTMs related to DDX5 Antibody (NBP1-83406).

Blogs on DDX5

There are no specific blogs for DDX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX5
Entrez