DDX27 Antibody - BSA Free

Western Blot: DDX27 Antibody [NBP1-91825] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: DDX27 Antibody [NBP1-91825] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DDX27 Antibody [NBP1-91825] - Staining of human cerebellum shows strong nucleolar and cytoplasmic positivity in Purkinje cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX27 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DDX27 Antibody - BSA Free (NBP1-91825) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGVFFEDASQYDENLSFQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX27
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DDX27 Protein (NBP1-91825PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX27 Antibody - BSA Free

• DEAD (Asp-Glu-Ala-Asp) box polypeptide 27
• DEAD box protein 27
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 27
• dJ686N3.1
• DKFZp667N057
• DRS1
• EC 3.6.1
• EC 3.6.4.13
• FLJ12917
• FLJ20596
• FLJ22238
• MGC1018
• MGC163147
• PP3241
• probable ATP-dependent RNA helicase DDX27
• RHLP
• RNA helicase-like protein
• Rrp3p

Background

DDX27 (DEAD-box protein 27) is a member of the DEAD box family of proteins that possesses several conserved motifs which include the highly conserved DEAD (Asp-Glu-Ala-Asp) amino acid sequence motif. The major activity of DEAD box proteins is to function as ATP-dependent RNA helicases. As helicases, DEAD proteins play an important role in all aspects of RNA metabolism and function which include pre-mRNA splicing, RNA synthesis, RNA degradation, RNA export, RNA translation, RNA secondary structure formation, ribosome biogenesis, and the assembly of RNP complexes. The function of DDX27 has not been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX27